Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Protein SMG7

 
Known also as: EST1-like protein C, SMG-7 homolog

Known abbreviations: hSMG-7, SMG7, C1orf16, EST1C, KIAA0250


Activities in which Protein SMG7 is involved: Pathways in which Protein SMG7 is involved:

NCBI GI number(s): 291327485
291327484
42475558
291327482
42476070
291327483
291327487
291327486
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q92540 Q92540
BRENDA - -
KEGG hsa:9887 hsa:9887
PFAM: PF10374
PF10373
PF10374
PF10373
InterPro: IPR018834
IPR019458
IPR011990
IPR018834
IPR019458
IPR011990
CATH: - -
SCOP: - -
Solved crystal structures: 1YA0
[PDB] [details]


Protein sequence:
MSLQSAQYLRQAEVLKADMTDSKLGPAEVWTSRQALQDLYQKMLVTDLEY
ALDKKVEQDLWNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASG
FYTQLLQELCTVFNVDLPCRVKSSQLGIISNKQTHTSAIVKPQSSSCSYI
CQHCLVHLGDIARYRNQTSQAESYYRHAAQLVPSNGQPYNQLAILASSKG
DHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFI
KAFIKFHGHVYLSKSLEKLSPLREKLEEQFKRLLFQKAFNSQQLVHVTVI
NLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNE
SQEESYNAYPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSF
HPHEEDLSSISATPLPEEFELQGFLALRPSFRNLDFSKGHQGITGDKEGQ
QRRIRQQRLISIGKWIADNQPRLIQCENEVGKLLFITEIPELILEDPSEA
KENLILQETSVIESLAADGSPGLKSVLSTSRNLSNNCDTGEKPVVTFKEN
IKTREVNRDQGRSFPPKEVRRDYSKGITVTKNDGKKDNNKRKTETKKCTL
EKLQETGKQNVAVQVKSQTELRKTPVSEARKTPVTQTPTQASNSQFIPIH
HPGAFPPLPSRPGFPPPTYVIPPPVAFSMGSGYTFPAGVSVPGTFLQPTA
HSPAGNQVQAGKQSHIPYSQQRPSGPGPMNQGPQQSQPPSQQPLTSLPAQ
PTAQSTSQLQVQALTQQQQSPTKAVPALGKSPPHHSGFQQYQQADASKQL
WNPPQVQGPLGKIMPVKQPYYLQTQDPIKLFEPSLQPPVMQQQPLEKKMK
PFPMEPYNHNPSEVKVPEFYWDSSYSMADNRSVMAQQANIDRRGKRSPGV
FRPEQDPVPRMPFEKSLLEKPSELMSHSSSFLSLTGFSLNQERYPNNSMF
NEVYGKNLTSSSKAELSPSMAPQETSLYSLFEGTPWSPSLPASSDHSTPA
SQSPHSSNPSSLPSSPPTHNHNSVPFSNFGPIGTPDNRDRRTADRWKTDK
PAMGGFGIDYLSATSSSESSWHQASTPSGTWTGHGPSMEDSSAVLMESLK
SIWSSSMMHPGPSALEQLLMQQKQKQQRGQGTMNPPH

Protein SMG7 (Homo sapiens) is product of expression of SMG7 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Phosphorylation of hUPF1 induces formation of mRNA surveillance complexes containing hSMG-5 and hSMG-7. Ohnishi T, Yamashita A, Kashima I, Schell T, Anders KR, Grimson A, Hachiya T, Hentze MW, Anderson P, Ohno S Mol Cell 2003-11-01 (12) 14636577
SMG7 is a 14-3-3-like adaptor in the nonsense-mediated mRNA decay pathway. Fukuhara N, Ebert J, Unterholzner L, Lindner D, Izaurralde E, Conti E Mol Cell 2005-01-18 (17) 15721257
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M Cell 2006-11-03 (127) 17081983
The DNA sequence and biological annotation of human chromosome 1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC Nature 2006-05-18 (441) 16710414
A quantitative atlas of mitotic phosphorylation. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP Proc Natl Acad Sci U S A 2008-08-05 (105) 18669648
Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T DNA Res 2002-06-01 (9) 12168954
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK Sci Signal 2009-01-01 (2) 19690332
Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain. Nagase T, Seki N, Ishikawa K, Ohira M, Kawarabayasi Y, Ohara O, Tanaka A, Kotani H, Miyajima N, Nomura N DNA Res 1996-10-31 (3) 9039502
SMG7 acts as a molecular link between mRNA surveillance and mRNA decay. Unterholzner L, Izaurralde E Mol Cell 2004-11-19 (16) 15546618
Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M Mol Cell 2008-08-08 (31) 18691976



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.