Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonuclease P protein component

 
Known also as: Protein C5

 

FUNCTION:
 
RNaseP catalyzes the removal of the 5'-leader sequence from pre-tRNA to produce the mature 5'-terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein component plays an auxiliary but essential role in vivo by binding to the 5'-leader sequence and broadening the substrate specificity of the ribozyme. HAMAP MF_00227
 
CATALYTIC ACTIVITY:
 
Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor. HAMAP MF_00227
 
SUBUNIT STRUCTURE:
 
Consists of a catalytic RNA component (M1 or RnpB) and a protein subunit.



This protein can be a part of a given complexes: Activities in which Ribonuclease P protein component is involved: Pathways in which Ribonuclease P protein component is involved:

NCBI GI number(s): 49175990
16131572
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A7Y8 P0A7Y8
BRENDA - -
KEGG eco:b3704 eco:b3704
PFAM: PF00825
PF00825
InterPro: IPR020568
IPR014721
IPR000100
IPR020539
IPR020568
IPR014721
IPR000100
IPR020539
CATH: - -
SCOP: - -
Solved crystal structures: 2LJP
[PDB] [details]


Protein sequence:
MVKLAFPRELRLLTPSQFTFVFQQPQRAGTPQITILGRLNSLGHPRIGLT
VAKKNVRRAHERNRIKRLTRESFRLRQHELPAMDFVVVAKKGVADLDNRA
LSEALEKLWRRHCRLARGS

Ribonuclease P protein component (Escherichia coli) is product of expression of rnpA gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science 1997-09-05 (277) 9278503
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol 2006-01-01 (2) 16738553
Physical mapping and nucleotide sequence of the rnpA gene that encodes the protein component of ribonuclease P in Escherichia coli. Hansen FG, Hansen EB, Atlung T Gene 1985-01-01 (38) 2415431
DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication. Burland V, Plunkett G 3rd, Daniels DL, Blattner FR Genomics 1993-06-01 (16) 7686882
The nucleotide sequence of the dnaA gene promoter and of the adjacent rpmH gene, coding for the ribosomal protein L34, of Escherichia coli. Hansen FG, Hansen EB, Atlung T EMBO J 1982-01-01 (1) 6329723



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.