Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Exportin-T

 
Known also as: Exportin(tRNA), Karyopherin-beta, tRNA exportin

Known abbreviations: LOS1

 

FUNCTION:
 
tRNA nucleus export receptor which facilitates tRNA translocation across the nuclear pore complex. Preferentially interacts with tRNAs with mature 5'- and 3'-termini and does not distinguish between intron-containing and spliced tRNAs. In the nucleus binds to tRNA and to the Ran-GTPases GSP1 or GSP2 in their active GTP-bound form. Docking of this trimeric complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of a nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP cause release of the tRNA from the export receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Involved in pre-tRNA splicing, probably by affecting the interaction of pre-tRNA with splicing endonuclease. 
 
SUBUNIT STRUCTURE:
 
Interacts with CEX1, GSP1, GSP2, NSP1, NUP2 and UTP8. 
 
CELLULAR LOCALIZATION:
 
Nucleus. Cytoplasm. Note: Shuttles between the nucleus and the cytoplasm and the localization is regulated by SNF1 kinase, nutrient supply and stress. 



Activities in which Exportin-T is involved: Pathways in which Exportin-T is involved:

NCBI GI number(s): 6322644
296146184
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P33418 P33418
BRENDA - -
KEGG sce:YKL205W sce:YKL205W
PFAM: PF08389
PF08389
InterPro: IPR016024
IPR013598
IPR016024
IPR013598
CATH: - -
SCOP: - -


Protein sequence:
MLERIQQLVNAVNDPRSDVATKRQAIELLNGIKSSENALEIFISLVINEN
SNDLLKFYGLSTLIELMTEGVNANPNGLNLVKFEITKWLKFQVLGNKQTK
LPDFLMNKISEVLTTLFMLMYSDCNGNQWNSFFDDLMSLFQVDSAISNTS
PSTDGNILLGLEFFNKLCLMINSEIADQSFIRSKESQLKNNNIKDWMRDN
DIMKLSNVWFQCLKLDEQIVSQCPGLINSTLDCIGSFISWIDINLIIDAN
NYYLQLIYKFLNLKETKISCYNCILAIISKKMKPMDKLAFLNMINLTNEL
TYYHQAISMNPQIITFDNLEVWESLTKLITSFGIEFTIIIEQVNDDQKLD
TLYKQSVISNVDSILLEKIIPILLEFMNNEFDSITAKTFPFWSNYLAFLK
KYKASSPNFVPLHKDFLDNFQQICFKRMKFSDDEVTQDDFEEFNETVRFK
LKNFQEIIVVIDPSLFLNNISQEISANLMNCKNESWQIFELTIYQIFNLS
ECTKNNYFGLNKNEIMTSQPSLTLVRFLNELLMMKDFLLAIDNEQIQILF
MELIVKNYNFIFSTSANTANATDDDEKYLLILNIFMSSFAMFNKRENVRL
RSWYLFTRFLKLTRINLKKILFANKNLVNEITNKISPLLHIKVTSINAQG
TDDNDTIFDNQLYIFEGIGFIITLNNSSQELTAATANTPIDYDILDQILT
PLFTQLEGCITQGASPVVILECHHILMAIGTLARGLHIGLVPENQVNNMV
VNKKLINDSLIHKFSNIAEVILVTFSFFNKFENIRDASRFTFARLIPILS
NKILPFINKLIELILSSTDLKSWEMIDFLGFLSQLIHMFHTDTDCYQLFN
QLLTPLINKVHSIIEEIDEQHDQQSSSNKPIDTAVTATSVNKNIVVTDSY
RDKILLKKAYCTFLQSFTNNSVTSILLSDINRAILPVILNDLVTYTPQEI
QETSMMKVSLNVLCNFIKCFGNGTCLDNDDINKDPNLKIDGLNEYFIMKC
VPIIFEIPFNPIYKFNIKEGNFKTMAYDLARLLRELFIVSSNPTTNENEC
VKYLTQIYLPQIQLPQELTIQLVNMLTTMGQKQFEKWFVDNFISVLKQGQ

Exportin-T (Saccharomyces cerevisiae) is product of expression of LOS1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Complete DNA sequence of yeast chromosome XI. Dujon B, Alexandraki D, Andre B, Ansorge W, Baladron V, Ballesta JP, Banrevi A, Bolle PA, Bolotin-Fukuhara M, Bossier P, et al. Nature 1994-06-02 (369) 8196765
Yeast Los1p has properties of an exportin-like nucleocytoplasmic transport factor for tRNA. Hellmuth K, Lau DM, Bischoff FR, Kunzler M, Hurt E, Simos G Mol Cell Biol 1998-11-01 (18) 9774653
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
The Saccharomyces cerevisiae LOS1 gene involved in pre-tRNA splicing encodes a nuclear protein that behaves as a component of the nuclear matrix. Shen WC, Selvakumar D, Stanford DR, Hopper AK J Biol Chem 1993-09-15 (268) 8366091
Processing of intervening sequences: a new yeast mutant which fails to excise intervening sequences from precursor tRNAs. Hopper AK, Schultz LD, Shapiro RA Cell 1980-03-01 (19) 7363329
Cloning and characterization of LOS1, a Saccharomyces cerevisiae gene that affects tRNA splicing. Hurt DJ, Wang SS, Lin YH, Hopper AK Mol Cell Biol 1987-03-01 (7) 3031485
Nuclear pore proteins are involved in the biogenesis of functional tRNA. Simos G, Tekotte H, Grosjean H, Segref A, Sharma K, Tollervey D, Hurt EC EMBO J 1996-05-01 (15) 8641292
Los1p, involved in yeast pre-tRNA splicing, positively regulates members of the SOL gene family. Shen WC, Stanford DR, Hopper AK Genetics 1996-06-01 (143) 8725220
tRNA nuclear export in saccharomyces cerevisiae: in situ hybridization analysis. Sarkar S, Hopper AK Mol Biol Cell 1998-11-01 (9) 9802895
A novel in vivo assay reveals inhibition of ribosomal nuclear export in ran-cycle and nucleoporin mutants. Hurt E, Hannus S, Schmelzl B, Lau D, Tollervey D, Simos G J Cell Biol 1999-01-08 (144) 9971735
Nucleotides of the tRNA D-stem that play an important role in nuclear-tRNA export in Saccharomyces cerevisiae. Cleary JD, Mangroo D Biochem J 2000-04-01 (None) 10727409
An aminoacylation-dependent nuclear tRNA export pathway in yeast. Grosshans H, Hurt E, Simos G Genes Dev 2000-04-01 (14) 10766739
Defects in tRNA processing and nuclear export induce GCN4 translation independently of phosphorylation of the alpha subunit of eukaryotic translation initiation factor 2. Qiu H, Hu C, Anderson J, Bjork GR, Sarkar S, Hopper AK, Hinnebusch AG Mol Cell Biol 2000-04-01 (20) 10713174
The nuclear tRNA aminoacylation-dependent pathway may be the principal route used to export tRNA from the nucleus in Saccharomyces cerevisiae. Steiner-Mosonyi M, Mangroo D Biochem J 2004-03-15 (378) 14640976
Retrograde movement of tRNAs from the cytoplasm to the nucleus in Saccharomyces cerevisiae. Shaheen HH, Hopper AK Proc Natl Acad Sci U S A 2005-08-09 (102) 16040803
tRNA actively shuttles between the nucleus and cytosol in yeast. Takano A, Endo T, Yoshihisa T Science 2005-07-01 (309) 15905365
The localization of nuclear exporters of the importin-beta family is regulated by Snf1 kinase, nutrient supply and stress. Quan X, Yu J, Bussey H, Stochaj U Biochim Biophys Acta 2007-07-01 (1773) 17544521
Impaired tRNA nuclear export links DNA damage and cell-cycle checkpoint. Ghavidel A, Kislinger T, Pogoutse O, Sopko R, Jurisica I, Emili A Cell 2007-11-01 (131) 18045534
Cex1p is a novel cytoplasmic component of the Saccharomyces cerevisiae nuclear tRNA export machinery. McGuire AT, Mangroo D EMBO J 2007-02-24 (26) 17203074
Utp8p is a nucleolar tRNA-binding protein that forms a complex with components of the nuclear tRNA export machinery in Saccharomyces cerevisiae. Strub BR, Eswara MB, Pierce JB, Mangroo D Mol Biol Cell 2007-10-01 (18) 17634288



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.