Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

CCA tRNA nucleotidyltransferase 1

 
Known also as: Mitochondrial tRNA nucleotidyl transferase, CCA-adding, mt CCA-adding enzyme, mt tRNA CCA-diphosphorylase, mt tRNA CCA-pyrophosphorylase, mt tRNA adenylyltransferase

Known abbreviations: TRNT1, CGI-47

 

FUNCTION:
 
Isoform 1: Adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates. Ref.9
Isoform 2: Adds 2 C residues (CC-) to the 3' terminus of tRNA molecules instead of a complete CCA end as isoform 1 does (in vitro). 
 
CATALYTIC ACTIVITY:
 
A tRNA precursor + 2 CTP + ATP = a tRNA with a 3' CCA end + 3 diphosphate.
 
COFACTOR:
 
Magnesium (Probable.)
 
SUBUNIT STRUCTURE:
 
Monomer, and homodimer; disulfide-linked.



Activities in which CCA tRNA nucleotidyltransferase 1 is involved: Pathways in which CCA tRNA nucleotidyltransferase 1 is involved:

NCBI GI number(s): 155030240
155030239
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q96Q11 Q96Q11
BRENDA - -
KEGG hsa:51095 hsa:51095
PFAM: PF01743
PF01743
InterPro: IPR002646
IPR002646
CATH: - -
SCOP: - -
Solved crystal structures: 1OU5
[PDB] [details]


Protein sequence:
MLRCLYHWHRPVLNRRWSRLCLPKQYLFTMKLQSPEFQSLFTEGLKSLTE
LFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRM
INNRGEKHGTITARLHEENFEITTLRIDVTTDGRHAEVEFTTDWQKDAER
RDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILR
YFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNH
VNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLF
KVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFI
IDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISS
GKEIGALLQQLREQWKKSGYQMEKDELLSYIKKT

CCA tRNA nucleotidyltransferase 1 (Homo sapiens) is product of expression of TRNT1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Identification and characterization of mammalian mitochondrial tRNA nucleotidyltransferases. Nagaike T, Suzuki T, Tomari Y, Takemoto-Hori C, Negayama F, Watanabe K, Ueda T J Biol Chem 2001-10-26 (276) 11504732
Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing. Simpson JC, Wellenreuther R, Poustka A, Pepperkok R, Wiemann S EMBO Rep 2000-09-01 (1) 11256614
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics. Lai CH, Chou CY, Ch'ang LY, Liu CS, Lin W Genome Res 2000-05-01 (10) 10810093
The full-ORF clone resource of the German cDNA Consortium. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I BMC Genomics 2007-01-01 (8) 17974005
The DNA sequence, annotation and analysis of human chromosome 3. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y Nature 2006-04-27 (440) 16641997
A splice variant of the human CCA-adding enzyme with modified activity. Lizano E, Schuster J, Muller M, Kelso J, Morl M J Mol Biol 2007-03-02 (366) 17204286
Lysine acetylation targets protein complexes and co-regulates major cellular functions. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M Science 2009-08-14 (325) 19608861
Crystal structure of the human CCA-adding enzyme: insights into template-independent polymerization. Augustin MA, Reichert AS, Betat H, Huber R, Morl M, Steegborn C J Mol Biol 2003-05-16 (328) 12729736



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.