Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

tRNA-splicing endonuclease subunit Sen15

 
Known also as: SEN15 homolog, HsSEN15, tRNA-intron endonuclease Sen15

Known abbreviations: TSEN15, C1orf19, SEN15

 

FUNCTION:
 
Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3' end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3' end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events.
 
SUBUNIT STRUCTURE:
 
Homodimer. tRNA splicing endonuclease is a heterotetramer composed of SEN2, SEN15, SEN34/LENG5 and SEN54. tRNA splicing endonuclease complex also contains proteins of the Pre-mRNA 3' end processing machinery such as CLP1, CPSF1, CPSF4 and CSTF2. 
 
CELLULAR LOCALIZATION:
 
Nucleus (Probable.) Nucleus › nucleolus (Probable.)
 
TISSUE SPECIFICITY:
 
Widely expressed. Highly expressed in testis and uterus.



This protein can be a part of a given complexes: Activities in which tRNA-splicing endonuclease subunit Sen15 is involved: Pathways in which tRNA-splicing endonuclease subunit Sen15 is involved:

NCBI GI number(s): 188528677
190360569
188528673
24308390
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q8WW01 Q8WW01
BRENDA - -
KEGG hsa:116461 hsa:116461
PFAM: PF12858
PF12858
InterPro: IPR024369
IPR024369
CATH: - -
SCOP: - -
Solved crystal structures: 2GW6
[PDB] [details]


Protein sequence:
MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMM
ELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGE
GLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTI
VYYKLTDGFMLPDPQNISLRR

TRNA-splicing endonuclease subunit Sen15 (Homo sapiens) is product of expression of TSEN15 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Identification of a human endonuclease complex reveals a link between tRNA splicing and pre-mRNA 3' end formation. Paushkin SV, Patel M, Furia BS, Peltz SW, Trotta CR Cell 2004-04-01 (117) 15109492
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Three-dimensional structure determined for a subunit of human tRNA splicing endonuclease (Sen15) reveals a novel dimeric fold. Song J, Markley JL J Mol Biol 2007-01-09 (366) 17166513
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Cloning and characterization of 13 novel transcripts and the human RGS8 gene from the 1q25 region encompassing the hereditary prostate cancer (HPC1) locus. Sood R, Bonner TI, Makalowska I, Stephan DA, Robbins CM, Connors TD, Morgenbesser SD, Su K, Faruque MU, Pinkett H, Graham C, Baxevanis AD, Klinger KW, Landes GM, Trent JM, Carpten JD Genomics 2001-04-15 (73) 11318611
The DNA sequence and biological annotation of human chromosome 1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC Nature 2006-05-18 (441) 16710414



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.