Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Glucose-repressible alcohol dehydrogenase transcriptional effector

 
Known also as: Carbon catabolite repressor protein 4, Cytoplasmic deadenylase

Known abbreviations: CCR4, FUN27

FUNCTION:

Acts as catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover. CCR4 has 3'-5' RNase activity with a strong preference for polyadenylated substrates and also low exonuclease activity towards single stranded DNA. Discovered because of its role in the control of ADH2 gene expression. It is required for the expression of genes involved in non-fermentative growth and it mediates or is required for the action of the SPT6 and SPT10 genes.

CATALYTIC ACTIVITY:

Exonucleolytic cleavage of poly(A) to 5'-AMP.

COFACTOR:

Magnesium.

SUBUNIT:

Subunit of the 1.0 MDa CCR4-NOT core complex that contains CCR4, CAF1, NOT1, NOT2, NOT3, NOT4, NOT5, CAF40 and CAF130. In the complex interacts with NOT1. The core complex probably is part of a less characterized 1.9 MDa CCR4-NOT complex.

CELLULAR LOCALIZATION:

Cytoplasm. Nucleus.

DOMAIN 

The 169 C-terminal residues are important for deadenylase activity.
 




This protein can be a part of a given complexes: Activities in which Glucose-repressible alcohol dehydrogenase transcriptional effector is involved: Pathways in which Glucose-repressible alcohol dehydrogenase transcriptional effector is involved:

NCBI GI number(s): 261567
399207
285810181
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P31384 P31384
BRENDA - -
KEGG sce:YAL021C sce:YAL021C
PFAM: PF03372
PF03372
InterPro: IPR005135
IPR001611
IPR003591
IPR005135
IPR001611
IPR003591
CATH: - -
SCOP: - -


Protein sequence:
MNDPSLLGYPNVGPQQQQQQQQQQHAGLLGKGTPNALQQQLHMNQLTGIP
PPGLMNNSDVHTSSNNNSRQLLDQLANGNANMLNMNMDNNNNNNNNNNNN
NNNGGGSGVMMNASTAAVNSIGMVPTVGTPVNINVNASNPLLHPHLDDPS
LLNNPIWKLQLHLAAVSAQSLGQPNIYARQNAMKKYLATQQAQQAQQQAQ
QQAQQQVPGPFGPGPQAAPPALQPTDFQQSHIAEASKSLVDCTKQALMEM
ADTLTDSKTAKKQQPTGDSTPSGTATNSAVSTPLTPKIELFANGKDEANQ
ALLQHKKLSQYSIDEDDDIENRMVMPKDSKYDDQLWHALDLSNLQIFNIS
ANIFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPAELG
SCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGNPLEKQFLKILTEKS
VTGLIFYLRDNRPEIPLPHERRFIEINTDGEPQREYDSLQQSTEHLATDL
AKRTFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQLLSYDSD
LLCLQEVESKTFEEYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCC
IFFKRDQFKLITKDAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLKL
QHIPSGDTIWAVTTHLHWDPKFNDVKTFQVGVLLDHLETLLKEETSHNFR
QDIKKFPVLICGDFNSYINSAVYELINTGRVQIHQEGNGRDFGYMSEKNF
SHNLALKSSYNCIGELPFTNFTPSFTDVIDYIWFSTHALRVRGLLGEVDP
EYESKFIGFPNDKFPSDHIPLLARFEFMKTNTGSKKV

Glucose-repressible alcohol dehydrogenase transcriptional effector (Saccharomyces cerevisiae) is product of expression of CCR4 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Ccr4p is the catalytic subunit of a Ccr4p/Pop2p/Notp mRNA deadenylase complex in Saccharomyces cerevisiae. Tucker M, Staples RR, Valencia-Sanchez MA, Muhlrad D, Parker R EMBO J 2002-03-15 (21) 11889048
Purification and characterization of the 1.0 MDa CCR4-NOT complex identifies two novel components of the complex. Chen J, Rappsilber J, Chiang YC, Russell P, Mann M, Denis CL J Mol Biol 2001-12-07 (314) 11733989
The nucleotide sequence of chromosome I from Saccharomyces cerevisiae. Bussey H, Kaback DB, Zhong W, Vo DT, Clark MW, Fortin N, Hall J, Ouellette BF, Keng T, Barton AB, et al. Proc Natl Acad Sci U S A 1995-04-25 (92) 7731988
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP J Proteome Res 2007-03-01 (6) 17330950
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A 2007-06-19 (104) 17563356
CCR4, a 3'-5' poly(A) RNA and ssDNA exonuclease, is the catalytic component of the cytoplasmic deadenylase. Chen J, Chiang YC, Denis CL EMBO J 2002-03-15 (21) 11889047
The NOT proteins are part of the CCR4 transcriptional complex and affect gene expression both positively and negatively. Liu HY, Badarinarayana V, Audino DC, Rappsilber J, Mann M, Denis CL EMBO J 1998-01-16 (17) 9463387
The CCR4 and CAF1 proteins of the CCR4-NOT complex are physically and functionally separated from NOT2, NOT4, and NOT5. Bai Y, Salvadore C, Chiang YC, Collart MA, Liu HY, Denis CL Mol Cell Biol 1999-10-01 (19) 10490603
The CCR4 protein from Saccharomyces cerevisiae contains a leucine-rich repeat region which is required for its control of ADH2 gene expression. Malvar T, Biron RW, Kaback DB, Denis CL Genetics 1992-12-01 (132) 1459446
Sequencing of chromosome I from Saccharomyces cerevisiae: analysis of a 32 kb region between the LTE1 and SPO7 genes. Ouellette BF, Clark MW, Keng T, Storms RK, Zhong W, Zeng B, Fortin N, Delaney S, Barton A, Kaback DB, et al. Genome 1993-01-01 (36) 8458570
Molecular cloning of chromosome I DNA from Saccharomyces cerevisiae: analysis of the genes in the FUN38-MAK16-SPO7 region. Barton AB, Kaback DB J Bacteriol 1994-04-01 (176) 8144453
The transcription factor associated Ccr4 and Caf1 proteins are components of the major cytoplasmic mRNA deadenylase in Saccharomyces cerevisiae. Tucker M, Valencia-Sanchez MA, Staples RR, Chen J, Denis CL, Parker R Cell 2001-01-09 (104) 11239395



Add your own comment!


There are no comments yet.

Last modification of this entry: 2010-04-12 18:49:44
Edited by a user: kaja
Edited content: Changed description.

Welcome stranger! Click here to login or here to register.