Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonuclease E

 
Known also as: RNase E

Known abbreviations: rne, ams, hmp1, b1084, JW1071

 

FUNCTION:
 
Matures 5S rRNA from its precursors from all the rRNA genes. It also cleaves RNA I, a molecule that controls the replication of colE1 plasmid DNA. It is the major endoribonuclease participating in mRNA turnover in E.coli. It initiates the decay of RNAs by cutting them internally near their 5'-end. It is able to remove poly(A) tails by an endonucleolytic process.
 
CATALYTIC ACTIVITY:
 
Endonucleolytic cleavage of single-stranded RNA in A- and U-rich regions.
 
SUBUNIT STRUCTURE:
 
Organized into a structure (processome or RNA degradosome) containing a number of RNA-processing enzymes including pnp (PNPase) and at reduced temperature deaD.
 
CELLULAR LOCALIZATION:
 
Cytoplasm.



This protein can be a part of a given complexes: Activities in which Ribonuclease E is involved: Pathways in which Ribonuclease E is involved:

NCBI GI number(s): 16129047
49175990
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P21513 P21513
BRENDA - -
KEGG eco:b1084 eco:b1084
PFAM: PF12111
PF10150
PF00575
PF12111
PF10150
PF00575
InterPro: IPR012340
IPR016027
IPR021968
IPR003029
IPR019307
IPR022967
IPR004659
IPR012340
IPR016027
IPR021968
IPR003029
IPR019307
IPR022967
IPR004659
CATH: - -
SCOP: - -
Solved crystal structures: 3H8A
3H1C
2FYM
2VRT
2VMK
2C4R
2C0B
2BX2
1SN8
1SMX
1SLJ
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MKRMLINATQQEELRVALVDGQRLYDLDIESPGHEQKKANIYKGKITRIE
PSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEV
IVQIDKEERGNKGAALTTFISLAGSYLVLMPNNPRAGGISRRIEGDDRTE
LKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWEAIKKAAES
RPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRP
DFSSKIKLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALT
AIDINSARATRGGDIEETAFNTNLEAADEIARQLRLRDLGGLIVIDFIDM
TPVRHQRAVENRLREAVRQDRARIQISHISRFGLLEMSRQRLSPSLGESS
HHVCPRCSGTGTVRDNESLSLSILRLIEEEALKENTQEVHAIVPVPIASY
LLNEKRSAVNAIETRQDGVRCVIVPNDQMETPHYHVLRVRKGEETPTLSY
MLPKLHEEAMALPSEEEFAERKRPEQPALATFAMPDVPPAPTPAEPAAPV
VAPAPKAAPATPAAPAQPGLLSRFFGALKALFSGGEETKPTEQPAPKAEA
KPERQQDRRKPRQNNRRDRNERRDTRSERTEGSDNREENRRNRRQAQQQT
AETRESRQQAEVTEKARTADEQQAPRRERSRRRNDDKRQAQQEAKALNVE
EQSVQETEQEERVRPVQPRRKQRQLNQKVRYEQSVAEEAVVAPVVEETVA
AEPIVQEAPAPRTELVKVPLPVVAQTAPEQQEENNADNRDNGGMPRRSRR
SPRHLRVSGQRRRRYRDERYPTQSPMPLTVACASPELASGKVWIRYPIVR
PQDVQVEEQREQEEVHVQPMVTEVPVAAAIEPVVSAPVVEEVAGVVEAPV
QVAEPQPEVVETTHPEVIAAAVTEQPQVITESDVAVAQEVAEQAEPVVEP
QEETADIEEVVETAEVVVAEPEVVAQPAAPVVAEVAAEVETVAAVEPEVT
VEHNHATAPMTRAPAPEYVPEAPRHSDWQRPTFAFEGKGAAGGHTATHHA
SAAPARPQPVE

Ribonuclease E (Escherichia coli) is product of expression of rne gene.

Ribonuclease E (Escherichia coli) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science 1997-09-05 (277) 9278503
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol 2006-01-01 (2) 16738553
A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al. DNA Res 1996-06-01 (3) 8905232
Cloning and analysis of the entire Escherichia coli ams gene. ams is identical to hmp1 and encodes a 114 kDa protein that migrates as a 180 kDa protein. Casaregola S, Jacq A, Laoudj D, McGurk G, Margarson S, Tempete M, Norris V, Holland IB J Mol Biol 1992-11-05 (228) 1447789
Analysis of the altered mRNA stability (ams) gene from Escherichia coli. Nucleotide sequence, transcriptional analysis, and homology of its product to MRP3, a mitochondrial ribosomal protein from Neurospora crassa. Claverie-Martin F, Diaz-Torres MR, Yancey SD, Kushner SR J Biol Chem 1991-01-15 (266) 1704367
Sequencing and expression of the rne gene of Escherichia coli. Chauhan AK, Miczak A, Taraseviciene L, Apirion D Nucleic Acids Res 1991-02-11 (19) 2011493
RNase E activity is conferred by a single polypeptide: overexpression, purification, and properties of the ams/rne/hmp1 gene product. Cormack RS, Genereaux JL, Mackie GA Proc Natl Acad Sci U S A 1993-10-01 (90) 8415644
Cleavage of poly(A) tails on the 3'-end of RNA by ribonuclease E of Escherichia coli. Walsh AP, Tock MR, Mallen MH, Kaberdin VR, von Gabain A, McDowall KJ Nucleic Acids Res 2001-05-01 (29) 11328869
Physical and functional interactions among RNase E, polynucleotide phosphorylase and the cold-shock protein, CsdA: evidence for a 'cold shock degradosome'. Prud'homme-Genereux A, Beran RK, Iost I, Ramey CS, Mackie GA, Simons RW Mol Microbiol 2004-12-01 (54) 15554978



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.