Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonuclease G

 
Known also as: RNase G, Cytoplasmic axial filament protein

Known abbreviations: rng, cafA, yhdF, b3247, JW3216

FUNCTION:

 
Involved in the processing of the 5'-end of 16S rRNA. Could be involved in chromosome segregation and cell division. It may be one of the components of the cytoplasmic axial filaments bundles or merely regulate the formation of this structure. 
 
CELLULAR LOCALIZATION:
 
Cytoplasm › cytoskeleton.



Activities in which Ribonuclease G is involved: Pathways in which Ribonuclease G is involved:

NCBI GI number(s): 90111563
49175990
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A9J0 P0A9J0
BRENDA - -
KEGG eco:b3247 eco:b3247
PFAM: PF10150
PF00575
PF10150
PF00575
InterPro: IPR012340
IPR016027
IPR003029
IPR019307
IPR022967
IPR004659
IPR012340
IPR016027
IPR003029
IPR019307
IPR022967
IPR004659
CATH: - -
SCOP: - -


Protein sequence:
MTAELLVNVTPSETRVAYIDGGILQEIHIEREARRGIVGNIYKGRVSRVL
PGMQAAFVDIGLDKAAFLHASDIMPHTECVAGEEQKQFTVRDISELVRQG
QDLMVQVVKDPLGTKGARLTTDITLPSRYLVFMPGASHVGVSQRIESESE
RERLKKVVAEYCDEQGGFIIRTAAEGVGEAELASDAAYLKRVWTKVMERK
KRPQTRYQLYGELALAQRVLRDFADAELDRIRVDSRLTYEALLEFTSEYI
PEMTSKLEHYTGRQPIFDLFDVENEIQRALERKVELKSGGYLIIDQTEAM
TTVDINTGAFVGHRNLDDTIFNTNIEATQAIARQLRLRNLGGIIIIDFID
MNNEDHRRRVLHSLEQALSKDRVKTSVNGFSALGLVEMTRKRTRESIEHV
LCNECPTCHGRGTVKTVETVCYEIMREIVRVHHAYDSDRFLVYASPAVAE
ALKGEESHSLAEVEIFVGKQVKVQIEPLYNQEQFDVVMM

Ribonuclease G (Escherichia coli) is product of expression of rng gene.

Ribonuclease G (Escherichia coli) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science 1997-09-05 (277) 9278503
Cytoplasmic axial filaments in Escherichia coli cells: possible function in the mechanism of chromosome segregation and cell division. Okada Y, Wachi M, Hirata A, Suzuki K, Nagai K, Matsuhashi M J Bacteriol 1994-01-01 (176) 8300545
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol 2006-01-01 (2) 16738553
Sequence of the downstream flanking region of the shape-determining genes mreBCD of Escherichia coli. Wachi M, Doi M, Ueda T, Ueki M, Tsuritani K, Nagai K, Matsuhashi M Gene 1991-09-01 (106) 1937035
Escherichia coli cafA gene encodes a novel RNase, designated as RNase G, involved in processing of the 5' end of 16S rRNA. Wachi M, Umitsuki G, Shimizu M, Takada A, Nagai K Biochem Biophys Res Commun 1999-06-07 (259) 10362534



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.