Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

5'-3' exoribonuclease 2

 
Known also as: Ribonucleic acid-trafficking protein 1, p116

Known abbreviations: RAT1, HKE1, TAP1, YOR048C, XRN2

FUNCTION:

Possesses 5'->3' exoribonuclease activity. Required for the processing of nuclear mRNA, rRNA and small nucleolar RNA (snoRNA) precursors. May promote termination of transcription by RNA polymerase II via the recruitment of 3'-end processing factors to the poly(A) site and by the degradation of nascent RNA downstream of the poly(A) site. 
 
CATALYTIC ACTIVITY:
 
Exonucleolytic cleavage in the 5'- to 3'-direction to yield nucleoside 5'-phosphates.
 
COFACTOR:
 
Magnesium or manganese.
 
ENZYME REGULATION:
 
Inhibited by nucleoside 3', 5'-bisphosphates. 
 
SUBUNIT STRUCTURE:
 
Interacts with RAI1 and RTT103. 
 
CELLULAR LOCALIZATION:
 
Nucleus.



Activities in which 5'-3' exoribonuclease 2 is involved: Pathways in which 5'-3' exoribonuclease 2 is involved:

NCBI GI number(s): 6324622
296148052
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q02792 Q02792
BRENDA - -
KEGG sce:YOR048C sce:YOR048C
PFAM: PF03159
PF03159
InterPro: IPR017151
IPR004859
IPR017151
IPR004859
CATH: - -
SCOP: - -


Protein sequence:
MGVPSFFRWLSRKYPKIISPVLEEQPQIVDGVILPLDYSASNPNGELDNL
YLDMNGIVHPCSHPENKPPPETEDEMLLAVFEYTNRVLNMARPRKVLVMA
VDGVAPRAKMNQQRARRFRSARDAQIENEAREEIMRQREEVGEIIDDAVR
NKKTWDSNAITPGTPFMDKLAAALRYWTAFKLATDPGWKNLQVIISDATV
PGEGEHKIMNFIRSQRADPEYNPNTTHCIYGLDADLIFLGLATHEPHFKI
LREDVFAQDNRKRNNLKDTINMTEEEKQFLQKQNSEQPFLWLHINVLREY
LSAELWVPGLPFTFDLERAIDDWVFMCFFCGNDFLPHLPCLDVRENSIDI
LLDIWKVVLPKLKTYMTCDGVLNLPSVETLLQHLGSREGDIFKTRHIQEA
RKKEAFERRKAQKNMSKGQDRHPTVATEQLQMYDTQGNLAKGSWNLTTSD
MVRLKKELMLANEGNEEAIAKVKQQSDKNNELMKDISKEEIDDAVSKANK
TNFNLAEVMKQKIINKKHRLEKDNEEEEIAKDSKKVKTEKAESECDLDAE
IKDEIVADVNDRENSETTEVSRDSPVHSTVNVSEGPKNGVFDTDEFVKLF
EPGYHERYYTAKFHVTPQDIEQLRKDMVKCYIEGVAWVLMYYYQGCASWN
WFYPYHYAPLATDFHGFSHLEIKFEEGTPFLPYEQLMSVLPAASGHALPK
IFRSLMSEPDSEIIDFYPEEFPIDMNGKKMSWQGIALLPFIDQDRLLTAV
RAQYPLLSDAERARNIRGEPVLLISNKNANYERFSKKLYSKENNNNNVVV
KFQHFKSGLSGIVSKDVEGFELNGKIVCPIQGGSLPNLSTTLILKMSYRL
IPLPSRNKSIILNGFIPSEPVLTAYDLDSIMYKYNNQNYSRRWNFGNDLK
QNIVPVGPKGITQYKPRTGGYRAFFYFAELSRNNVQPAHNYGRNSYNSQP
GFNNSRYDGGNNNYRQNSNYRNNNYSGNRNSGQYSGNSYSRNNKQSRYDN
SRANRR

5'-3' exoribonuclease 2 (Saccharomyces cerevisiae) is product of expression of RAT1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of Saccharomyces cerevisiae chromosome VII. Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K Nature 1997-05-01 (387) 9169869
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Degradation of normal mRNA in the nucleus of Saccharomyces cerevisiae. Das B, Butler JS, Sherman F Mol Cell Biol 2003-08-01 (23) 12897126
Sequence of a 39,411 bp DNA fragment covering the left end of chromosome VII of Saccharomyces cerevisiae. Coissac E, Maillier E, Robineau S, Netter P Yeast 1996-12-01 (12) 8972578
Saccharomyces cerevisiae RAI1 (YGL246c) is homologous to human DOM3Z and encodes a protein that binds the nuclear exoribonuclease Rat1p. Xue Y, Bai X, Lee I, Kallstrom G, Ho J, Brown J, Stevens A, Johnson AW Mol Cell Biol 2000-06-01 (20) 10805743
Intersection of the Kap123p-mediated nuclear import and ribosome export pathways. Sydorskyy Y, Dilworth DJ, Yi EC, Goodlett DR, Wozniak RW, Aitchison JD Mol Cell Biol 2003-03-01 (23) 12612077
The yeast Rat1 exonuclease promotes transcription termination by RNA polymerase II. Kim M, Krogan NJ, Vasiljeva L, Rando OJ, Nedea E, Greenblatt JF, Buratowski S Nature 2004-11-25 (432) 15565157
Rat1p and Rai1p function with the nuclear exosome in the processing and degradation of rRNA precursors. Fang F, Phillips S, Butler JS RNA 2005-10-01 (11) 16131592
The yeast 5'-3' exonuclease Rat1p functions during transcription elongation by RNA polymerase II. Jimeno-Gonzalez S, Haaning LL, Malagon F, Jensen TH... Mol Cell 2010-01-26 (37) 20188675



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-11-23 12:01:12
Edited by a user: kaja
Edited content: Changed uniprot and abbreviations.

Welcome stranger! Click here to login or here to register.