Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

20S-pre-rRNA D-site endonuclease NOB1

 
Known also as: NIN1-binding protein, Pre-rRNA-processing endonuclease NOB1

Known abbreviations: NOB1, YOR056C, YOR29-07

 

FUNCTION:
 
Required for the synthesis of 40S ribosome subunits. Has a role in processing 20S pre-rRNA into the mature 18S rRNA, where it is required for cleavage at the 3' end of the mature 18S rRNA (D-site). Accompanies the 20S pre-rRNA from the nucleus to the cytoplasm. In association with NIN1, may promote the recruitment of the proteasome to the ribosomal subunits stalled in maturation.
 
SUBUNIT STRUCTURE:
 
Component of the small ribosomal subunit, ribosomal RNA processing complex (SSU RRP complex). Interacts with PNO1.
 
CELLULAR LOCALIZATION:
 
Cytoplasm. Nucleus › nucleolus. Endoplasmic reticulum



Activities in which 20S-pre-rRNA D-site endonuclease NOB1 is involved: Pathways in which 20S-pre-rRNA D-site endonuclease NOB1 is involved:

NCBI GI number(s): 6324630
296148057
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q08444 Q08444
BRENDA - -
KEGG sce:YOR056C sce:YOR056C
PFAM: PF08772
PF08772
InterPro: IPR017117
IPR014881
IPR006596
IPR017117
IPR014881
IPR006596
CATH: - -
SCOP: - -


Protein sequence:
MTENQTAHVRALILDATPLITQSYTHYQNYAQSFYTTPTVFQEIKDAQAR
KNLEIWQSLGTLKLVHPSENSIAKVSTFAKLTGDYSVLSANDLHILALTY
ELEIKLNNGDWRLRKKPGDALDASKADVGTDGKQKLTEDNKKEEDSESVP
KKKNKRRGGKKQKAKREAREAREAENANLELESKAEEHVEEAGSKEQICN
DENIKESSDLNEVFEDADDDGDWITPENLTEAIIKDSGEDTTGSLGVEAS
EEDRHVALNRPENQVALATGDFAVQNVALQMNLNLMNFMSGLKIKRIRNY
MLRCHACFKIFPLPKDGKPKHFCASCGGQGTLLRCAVSVDSRTGNVTPHL
KSNFQWNNRGNRYSVASPLSKNSQKRYGKKGHVHSKPQENVILREDQKEY
EKVIKQEEWTRRHNEKILNNWIGGGSADNYISPFAITGLKQHNVRIGKGR
YVNSSKRRS

20S-pre-rRNA D-site endonuclease NOB1 (Saccharomyces cerevisiae) is product of expression of NOB1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. Nature 1997-05-01 (387) 9169874
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
The sequence of a 54.7 kb fragment of yeast chromosome XV reveals the presence of two tRNAs and 24 new open reading frames. Valens M, Bohn C, Daignan-Fornier B, Dang VD, Bolotin-Fukuhara M Yeast 1997-03-01 (13) 9133743
Nob1p is required for biogenesis of the 26S proteasome and degraded upon its maturation in Saccharomyces cerevisiae. Tone Y, Toh-E A Genes Dev 2002-12-15 (16) 12502737
The path from nucleolar 90S to cytoplasmic 40S pre-ribosomes. Schafer T, Strauss D, Petfalski E, Tollervey D, Hurt E EMBO J 2003-03-17 (22) 12628929
Nob1p is required for cleavage of the 3' end of 18S rRNA. Fatica A, Oeffinger M, Dlakic M, Tollervey D Mol Cell Biol 2003-03-01 (23) 12588997
Dim2p, a KH-domain protein required for small ribosomal subunit synthesis. Vanrobays E, Gelugne JP, Caizergues-Ferrer M, Lafontaine DL RNA 2004-04-01 (10) 15037774
PIN domain of Nob1p is required for D-site cleavage in 20S pre-rRNA. Fatica A, Tollervey D, Dlakic M RNA 2004-11-01 (10) 15388878



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.