Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RNA exonuclease 1

 
Known also as: RNase H(70)

Known abbreviations: RNH70, REX1, YGR276C, G9381

 

FUNCTION:
 
3' exoribonuclease required for 5S rRNA maturation and for the proper maturation of the 5' cistron of the tRNA-Arg3 dicistronic gene. Involved with REX2 in the maturation of the 5.8S rRNA, and with REX2 and REX3, in the 3' processing of the U5L snRNA. 
 
CELLULAR LOCALIZATION:
 
Nucleus
 



Activities in which RNA exonuclease 1 is involved: Pathways in which RNA exonuclease 1 is involved:

NCBI GI number(s): 6321715
296145303
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P53331 P53331
BRENDA - -
KEGG sce:YGR276C sce:YGR276C
PFAM: PF00929
PF00929
InterPro: IPR006055
IPR013520
IPR012337
IPR006055
IPR013520
IPR012337
CATH: - -
SCOP: - -


Protein sequence:
MQVEGPDTNFVSDLALGSKKRRLSKTSVQEDDHTNVVSEVNKNKKKKKAK
PMTCTLLKSVVEKGIGIKDVRDMTQYLLQAENNSPKWIDICNRSSLQKMI
VLFIPGLQPDDFENGKNTFNEISDDNFKYIPGEIASTFHTFPVMAPGSKM
TLFSPYNSFINVGLSKMEKINKLKELQKKKKITINDLVLSEQQLVANDYP
LDSGDTNFDTDWVQTVDFTHGGSHIFALDCEMCLSEQGLVLTRISLVNFD
NEVIYEELVKPDVPIVDYLTRYSGITEEKLTVGAKKTLREVQKDLLKIIS
RSDILIGHSLQNDLKVMKLKHPLVVDTAIIYHHKAGDPFKPSLKYLSETF
LNKSIQNGEHDSVEDARACLELTKLKILNGLAFGIGINTENLFTKLHRFE
VKTVLLNDMIIKNHTEDDSKGQLIRCVEDDETWTHIHENLNKDVKLIVGR
IKNLERSRNYNKKPRKETPSFDASMVLHDIGQHLTQLYENATPGTMILIM
SGTGDTRPWNNLSTELEFIQDKKERLDKRREREPEIVEAIKLARGGVASF
TVK

RNA exonuclease 1 (Saccharomyces cerevisiae) is product of expression of RNH70 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Three conserved members of the RNase D family have unique and overlapping functions in the processing of 5S, 5.8S, U4, U5, RNase MRP and RNase P RNAs in yeast. van Hoof A, Lennertz P, Parker R EMBO J 2000-03-15 (19) 10716935
Rex1p deficiency leads to accumulation of precursor initiator tRNAMet and polyadenylation of substrate RNAs in Saccharomyces cerevisiae. Ozanick SG, Wang X, Costanzo M, Brost RL, Boone C, Anderson JT Nucleic Acids Res 2009-02-01 (37) 19042972
The nucleotide sequence of Saccharomyces cerevisiae chromosome VII. Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K Nature 1997-05-01 (387) 9169869
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
The sequence of a 8 kb segment on the right arm of yeast chromosome VII identifies four new open reading frames and the genes for yTAFII145. Ruzzi M, Marconi A, Saliola M, Fabiani L, Montebove F, Frontali L Yeast 1997-03-01 (13) 9133740
Purification of Saccharomyces cerevisiae RNase H(70) and identification of the corresponding gene. Frank P, Braunshofer-Reiter C, Karwan A, Grimm R, Wintersberger U FEBS Lett 1999-05-07 (450) 10359084
Synergistic defect in 60S ribosomal subunit assembly caused by a mutation of Rrs1p, a ribosomal protein L11-binding protein, and 3'-extension of 5S rRNA in Saccharomyces cerevisiae. Nariai M, Tanaka T, Okada T, Shirai C, Horigome C, Mizuta K Nucleic Acids Res 2005-01-01 (33) 16100378



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-07-05 14:32:46
Edited by a user: kaja
Edited content: Changed publications.

Welcome stranger! Click here to login or here to register.