Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Nuclear cap-binding protein complex subunit 1

 
Known also as: 80 kDa nuclear cap-binding protein, NCBP 80 kDa subunit,Glycolysis regulation protein 3,Protein SUT1,Suppressor of TOP1 protein

Known abbreviations: STO1, CBC1, CBP80, GCR3, SUT1, YMR125W, YM8564.07, YM9553.01

 

FUNCTION:
 
Component of the CBC complex, which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in maturation, export and degradation of nuclear mRNAs. The CBC complex is required for efficient pre-mRNA splicing through efficient commitment complex and spliceosome formation. Together with NPL3, the CBC complex is required for export of mRNAs out of the nucleus. The CBC complex is also involved in nuclear mRNA degradation, probably by directing the mRNAs to the sites of degradation. Affects replication of the positive-strand RNA virus BMV. 
 
SUBUNIT STRUCTURE:
 
Component of the nuclear cap-binding complex (CBC), a heterodimer composed of STO1/CBC1 and CBC2 that interacts with capped RNAs. The complex interacts strongly with the importin subunit alpha SRP1. The SRP1-CBC trimer also binds to capped RNAs, but formation of the importin alpha/beta heterodimer upon binding of KAP95 to SRP1 in the cytoplasm causes dissociation of CBC from the RNA. The CBC complex is part of the commitment complex 1 (CC1), binding to the cap of pre-mRNA and interacting with U1 snRNP subunits MUD2 and SNU56. The CBC complex is part of the NRD1 complex, composed of CBC2, NAB1, NRD1, SEN1 and STO1/CBC2. The CBC complex also interacts with NPL3 and eIF4G (TIF4631 and TIF4632). 
 
CELLULAR LOCALIZATION:
 
Nucleus. Cytoplasm › perinuclear region. Note: Predominantly nuclear, is able to exit the nucleus in an RNA-dependent manner.



Activities in which Nuclear cap-binding protein complex subunit 1 is involved: Pathways in which Nuclear cap-binding protein complex subunit 1 is involved:

NCBI GI number(s): 6579194
296147242
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P34160 P34160
BRENDA - -
KEGG sce:YMR125W sce:YMR125W
PFAM: PF02854
PF09088
PF09090
PF02854
PF09088
PF09090
InterPro: IPR016024
IPR016021
IPR015172
IPR015174
IPR003890.
IPR016024
IPR016021
IPR015172
IPR015174
IPR003890.
CATH: - -
SCOP: - -


Protein sequence:
MFNRKRRGDFDEDENYRDFRPRMPKRQRIPPVVQLCKEMMPDIRTIGESV
KAFEDDIKFLSEAIMNEYGHEDYFNNALLSTLNAVVVEQPQKQAAIALLT
MVVNSKNNVAGKSIINYFFEELQKWCKQTYNDEFKSTSNETGPWNKIKLI
LRFLSILSPMFLVDELINIYKSLFELSIELNNLDPGNRVPLSEAIYTNTL
LNIPYLFFFNRNNDGLRTKVEELLAYVEQNYLVKTTDINLLREYNGEPPY
EMVELVRVVLPNVKKALINNLEQLNELFPDWNHLLTPQTGDEGFNDALTL
PSVDDLKSFVRLNKNFGSVDSMWKTPRYAFHVYLPNSAGNFETVVPISTY
AGQLFNDIIIDLVESLEFNRKEVARQVITLDLFFKAGIFTEPGESIAQLI
ATYEENPLAPTFKIEDLAIETILGLIFKLPSVSQPFAYFYTLLVDICQNS
PKAIAPVFGRAFRFFYSHLDSLDFELKLRYLDWFSIQMSNFNFSWKWNEW
EDDSIKFGKYFYNPKVNFAKNLIQKELRLTSNFSEVEDSLPQEFTKYLDT
SYIPRDQLINYYQSLFTGYTVEEDSVRKNDLYFRQEGVPMENTVRKILDY
THKANNSREVTELESILGELKNEYGSIISDFNRFVIILLVQAVTDSGSRS
LSHANKYINDLKEDLKTIFAKIELDIETKEYIIIEAVLTFWNANPQTGFL
VADAFKYAGLLTSRTIFTFIFNETGLKNNGLIEATAIEAVFRNLSQQISE
ENESGNNFEFVFERLCTIANSTIDLLDVNADEDIEIPKVNGEMDIDDIED
DKLDLKWKYFTVIGFIKSILRRYSHEYRELADKFIANIDNAIPHESTRRT
ISNWIQETKEV

Nuclear cap-binding protein complex subunit 1 (Saccharomyces cerevisiae) is product of expression of STO1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII. Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B Nature 1997-05-01 (387) 9169872
Identification of eight proteins that cross-link to pre-mRNA in the yeast commitment complex. Zhang D, Rosbash M Genes Dev 1999-03-01 (13) 10072386
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Importin provides a link between nuclear protein import and U snRNA export. Gorlich D, Kraft R, Kostka S, Vogel F, Hartmann E, Laskey RA, Mattaj IW, Izaurralde E Cell 1996-10-04 (87) 8858145
A yeast cap binding protein complex (yCBC) acts at an early step in pre-mRNA splicing. Lewis JD, Gorlich D, Mattaj IW Nucleic Acids Res 1996-09-01 (24) 8811086
Genetic and physical interactions involving the yeast nuclear cap-binding complex. Fortes P, Kufel J, Fornerod M, Polycarpou-Schwarz M, Lafontaine D, Tollervey D, Mattaj IW Mol Cell Biol 1999-10-01 (19) 10490594
A generic protein purification method for protein complex characterization and proteome exploration. Rigaut G, Shevchenko A, Rutz B, Wilm M, Mann M, Seraphin B Nat Biotechnol 1999-10-01 (17) 10504710
7The yeast mRNA-binding protein Npl3p interacts with the cap-binding complex. Shen EC, Stage-Zimmermann T, Chui P, Silver PA J Biol Chem 2000-08-04 (275) 10823828
Systematic, genome-wide identification of host genes affecting replication of a positive-strand RNA virus. Kushner DB, Lindenbach BD, Grdzelishvili VZ, Noueiry AO, Paul SM, Ahlquist P Proc Natl Acad Sci U S A 2003-12-23 (100) 14671320
The interaction of the cap-binding complex (CBC) with eIF4G is dispensable for translation in yeast. Baron-Benhamou J, Fortes P, Inada T, Preiss T, Hentze MW RNA 2003-06-01 (9) 12756324
Cap-binding protein 1-mediated and eukaryotic translation initiation factor 4E-mediated pioneer rounds of translation in yeast. Gao Q, Das B, Sherman F, Maquat LE Proc Natl Acad Sci U S A 2005-03-22 (102) 15753296
A nuclear degradation pathway controls the abundance of normal mRNAs in Saccharomyces cerevisiae. Kuai L, Das B, Sherman F Proc Natl Acad Sci U S A 2005-09-27 (102) 16166263
Subunit architecture of multimeric complexes isolated directly from cells. Hernandez H, Dziembowski A, Taverner T, Seraphin B, Robinson CV EMBO Rep 2006-06-01 (7) 16729021
Nrd1 interacts with the nuclear exosome for 3' processing of RNA polymerase II transcripts. Vasiljeva L, Buratowski S Mol Cell 2006-02-20 (21) 16427013
GCR3 encodes an acidic protein that is required for expression of glycolytic genes in Saccharomyces cerevisiae. Uemura H, Jigami Y J Bacteriol 1992-09-01 (174) 1512188
Mutations in GCR3, a gene involved in the expression of glycolytic genes in Saccharomyces cerevisiae, suppress the temperature-sensitive growth of hpr1 mutants. Uemura H, Pandit S, Jigami Y, Sternglanz R Genetics 1996-04-01 (142) 8846890
The role of nuclear cap binding protein Cbc1p of yeast in mRNA termination and degradation. Das B, Guo Z, Russo P, Chartrand P, Sherman F Mol Cell Biol 2000-04-01 (20) 10733586
Arginine methylation facilitates the nuclear export of hnRNP proteins. Shen EC, Henry MF, Weiss VH, Valentini SR, Silver PA, Lee MS Genes Dev 1998-03-01 (12) 9499403
Eukaryote-specific domains in translation initiation factors: implications for translation regulation and evolution of the translation system. Aravind L, Koonin EV Genome Res 2000-08-01 (10) 10958635
The yeast nuclear cap binding complex can interact with translation factor eIF4G and mediate translation initiation. Fortes P, Inada T, Preiss T, Hentze MW, Mattaj IW, Sachs AB Mol Cell 2000-07-01 (6) 10949040
Degradation of normal mRNA in the nucleus of Saccharomyces cerevisiae. Das B, Butler JS, Sherman F Mol Cell Biol 2003-08-01 (23) 12897126



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.