Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Nuclear cap-binding protein subunit 2

 
Known also as: 20 kDa nuclear cap-binding protein,NCBP 20 kDa subunit

Known abbreviations: CBC2, CBP20, MUD13, SAE1, YPL178W

 

FUNCTION:
 
Component of the CBC complex, which binds co-transcriptionally to the cap of pre-mRNAs and is involved in maturation, export and degradation of nuclear mRNAs. The CBC complex is required for efficient pre-mRNA splicing through efficient commitment complex and spliceosome formation. Together with NPL3, the CBC complex is required for export of mRNAs out of the nucleus. The CBC complex is also involved in nuclear mRNA degradation, probably by directing the mRNAs to the sites of degradation. Affects replication of the positive-strand RNA virus BMV. 
 
SUBUNIT STRUCTURE:
 
Component of the nuclear cap-binding complex (CBC), a heterodimer composed of STO1/CBC1 and CBC2 that interacts with capped RNAs. The complex interacts strongly with the importin subunit alpha SRP1. The SRP1-CBC trimer also binds to capped RNAs, but formation of the importin alpha/beta heterodimer upon binding of KAP95 to SRP1 in the cytoplasm causes dissociation of CBC from the RNA. The CBC complex is part of the commitment complex 1 (CC1), binding to the cap of pre-mRNA and interacting with U1 snRNP subunits MUD2 and SNU56. The CBC complex is part of the NRD1 complex, composed of CBC2, NAB1, NRD1, SEN1 and STO1/CBC2. The CBC complex also interacts with NPL3 and eIF4G (TIF4631 and TIF4632). 
 
CELLULAR LOCALIZATION:
 
Nucleus. Cytoplasm › perinuclear region. Note: Predominantly nuclear, is able to exit the nucleus in an RNA-dependent manner.



Activities in which Nuclear cap-binding protein subunit 2 is involved: Pathways in which Nuclear cap-binding protein subunit 2 is involved:

NCBI GI number(s): 6325079
296148479
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q08920 Q08920
BRENDA - -
KEGG sce:YPL178W sce:YPL178W
PFAM: PF00076
PF00076
InterPro: IPR012677
IPR000504
IPR012677
IPR000504
CATH: - -
SCOP: - -


Protein sequence:
MSLEEFDEVKYDHSTKRLDTPSRYLLRKARRNPNGLQELRESMKSSTIYV
GNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEA
LNALKYLSDTKLDEKTITIDLDPGFEDGRQFGRGKSGGQVSDELRFDFDA
SRGGFAIPFAERVGVPHSRFDNSSSQSNTNNYIPPPDAMGTFRPGFDEER
EDDNYVPQ

Nuclear cap-binding protein subunit 2 (Saccharomyces cerevisiae) is product of expression of CBC2 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI. Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B, Badcock K, Benes V, Botstein D, Bowman S, Bruckner M, Carpenter J, Cherry JM, Chung E, Churcher C, Coster F, Davis K, Davis RW, Dietrich FS, Delius H, DiPaolo T, Hani J, et al. Nature 1997-05-01 (387) 9169875
The yeast splicing factor Mud13p is a commitment complex component and corresponds to CBP20, the small subunit of the nuclear cap-binding complex. Colot HV, Stutz F, Rosbash M Genes Dev 1996-07-01 (10) 8682299
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Importin provides a link between nuclear protein import and U snRNA export. Gorlich D, Kraft R, Kostka S, Vogel F, Hartmann E, Laskey RA, Mattaj IW, Izaurralde E Cell 1996-10-04 (87) 8858145
A yeast cap binding protein complex (yCBC) acts at an early step in pre-mRNA splicing. Lewis JD, Gorlich D, Mattaj IW Nucleic Acids Res 1996-09-01 (24) 8811086
Mutations in Saccharomyces cerevisiae that block meiotic prophase chromosome metabolism and confer cell cycle arrest at pachytene identify two new meiosis-specific genes SAE1 and SAE3. McKee AH, Kleckner N Genetics 1997-07-01 (146) 9215889
Genetic and physical interactions involving the yeast nuclear cap-binding complex. Fortes P, Kufel J, Fornerod M, Polycarpou-Schwarz M, Lafontaine D, Tollervey D, Mattaj IW Mol Cell Biol 1999-10-01 (19) 10490594
A generic protein purification method for protein complex characterization and proteome exploration. Rigaut G, Shevchenko A, Rutz B, Wilm M, Mann M, Seraphin B Nat Biotechnol 1999-10-01 (17) 10504710
7The yeast mRNA-binding protein Npl3p interacts with the cap-binding complex. Shen EC, Stage-Zimmermann T, Chui P, Silver PA J Biol Chem 2000-08-04 (275) 10823828
Systematic, genome-wide identification of host genes affecting replication of a positive-strand RNA virus. Kushner DB, Lindenbach BD, Grdzelishvili VZ, Noueiry AO, Paul SM, Ahlquist P Proc Natl Acad Sci U S A 2003-12-23 (100) 14671320
The interaction of the cap-binding complex (CBC) with eIF4G is dispensable for translation in yeast. Baron-Benhamou J, Fortes P, Inada T, Preiss T, Hentze MW RNA 2003-06-01 (9) 12756324
Cap-binding protein 1-mediated and eukaryotic translation initiation factor 4E-mediated pioneer rounds of translation in yeast. Gao Q, Das B, Sherman F, Maquat LE Proc Natl Acad Sci U S A 2005-03-22 (102) 15753296
A nuclear degradation pathway controls the abundance of normal mRNAs in Saccharomyces cerevisiae. Kuai L, Das B, Sherman F Proc Natl Acad Sci U S A 2005-09-27 (102) 16166263
Subunit architecture of multimeric complexes isolated directly from cells. Hernandez H, Dziembowski A, Taverner T, Seraphin B, Robinson CV EMBO Rep 2006-06-01 (7) 16729021
Nrd1 interacts with the nuclear exosome for 3' processing of RNA polymerase II transcripts. Vasiljeva L, Buratowski S Mol Cell 2006-02-20 (21) 16427013



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.