Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Eukaryotic peptide chain release factor subunit 1

 
Known also as: Eukaryotic release factor 1, Omnipotent suppressor protein 1

Known abbreviations: eRF1, SUP45, SAL4, SUP1, YBR143C, YBR1120

 

FUNCTION:
 
Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA (By similarity.)
 
SUBUNIT STRUCTURE:
 
Heterodimer of two subunits, one of which binds GTP. Interacts with TPA1. 
 
CELLULAR LOCALIZATION:
 
Cytoplasm
 
POST-TRANSLATIONAL MODIFICATION:
 
N5-methylated on Gln-182 by MTQ2.



Activities in which Eukaryotic peptide chain release factor subunit 1 is involved: Pathways in which Eukaryotic peptide chain release factor subunit 1 is involved:

NCBI GI number(s): 6319619
296142807
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P12385 P12385
BRENDA - -
KEGG sce:YBR143C sce:YBR143C
PFAM: PF03463
PF03464
PF03465
PF03463
PF03464
PF03465
InterPro: IPR005140
IPR005141
IPR005142
IPR004403
IPR024049
IPR005140
IPR005141
IPR005142
IPR004403
IPR024049
CATH: - -
SCOP: - -


Protein sequence:
MDNEVEKNIEIWKVKKLVQSLEKARGNGTSMISLVIPPKGQIPLYQKMLT
DEYGTASNIKSRVNRLSVLSAITSTQQKLKLYNTLPKNGLVLYCGDIITE
DGKEKKVTFDIEPYKPINTSLYLCDNKFHTEVLSELLQADDKFGFIVMDG
QGTLFGSVSGNTRTVLHKFTVDLPKKHGRGGQSALRFARLREEKRHNYVR
KVAEVAVQNFITNDKVNVKGLILAGSADFKTDLAKSELFDPRLACKVISI
VDVSYGGENGFNQAIELSAEALANVKYVQEKKLLEAYFDEISQDTGKFCY
GIDDTLKALDLGAVEKLIVFENLETIRYTFKDAEDNEVIKFAEPEAKDKS
FAIDKATGQEMDVVSEEPLIEWLAANYKNFGATLEFITDKSSEGAQFVTG
FGGIGAMLRYKVNFEQLVDESEDEYYDEDEGSDYDFI

Eukaryotic peptide chain release factor subunit 1 (Saccharomyces cerevisiae) is product of expression of SUP45 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
Complete DNA sequence of yeast chromosome II. Feldmann H, Aigle M, Aljinovic G, Andre B, Baclet MC, Barthe C, Baur A, Becam AM, Biteau N, Boles E, Brandt T, Brendel M, Bruckner M, Bussereau F, Christiansen C, Contreras R, Crouzet M, Cziepluch C, Demolis N, Delaveau T, Doignon F, Domdey H, Dusterhus S, Dubois E, Dujon B, El Bakkoury M, Entian KD EMBO J 1994-12-15 (13) 7813418
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
The products of the SUP45 (eRF1) and SUP35 genes interact to mediate translation termination in Saccharomyces cerevisiae. Stansfield I, Jones KM, Kushnirov VV, Dagkesamanskaya AR, Poznyakovski AI, Paushkin SV, Nierras CR, Cox BS, Ter-Avanesyan MD, Tuite MF EMBO J 1995-09-01 (14) 7556078
Tpa1p is part of an mRNP complex that influences translation termination, mRNA deadenylation, and mRNA turnover in Saccharomyces cerevisiae. Keeling KM, Salas-Marco J, Osherovich LZ, Bedwell DM Mol Cell Biol 2006-07-01 (26) 16809762
Yeast omnipotent supressor SUP1 (SUP45): nucleotide sequence of the wildtype and a mutant gene. Breining P, Piepersberg W Nucleic Acids Res 1986-07-11 (14) 3526282
[Nucleotide sequence of a mutant allele and wild type allele SUP1 and comparison of transcripts of SUP1 and SUP2 genes]. Surguchev AP, Telkov MV, Smirnov VN, Breining P, Piepersberg W Mol Biol (Mosk) 1987-01-01 (21) 3037308
Sequence and function analysis of a 2.73 kb fragment of Saccharomyces cerevisiae chromosome II. Miosga T, Zimmermann FK Yeast 1993-11-01 (9) 8109177
The glutamine residue of the conserved GGQ motif in Saccharomyces cerevisiae release factor eRF1 is methylated by the product of the YDR140w gene. Heurgue-Hamard V, Champ S, Mora L, Merkulova-Rainon T, Kisselev LL, Buckingham RH J Biol Chem 2005-02-28 (280) 15509572
The yeast translation release factors Mrf1p and Sup45p (eRF1) are methylated, respectively, by the methyltransferases Mtq1p and Mtq2p. Polevoda B, Span L, Sherman F J Biol Chem 2006-01-03 (281) 16321977



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.