Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Eukaryotic peptide chain release factor GTP-binding subunit

 
Known also as: G1 to S phase transition protein 1,Omnipotent suppressor protein 2,PSI no more protein 2,Polypeptide release factor 3,Translation release factor 3,

Known abbreviations: ERF-3, ERF2, SUP35, GST1, PNM2, SAL3, SUF12, SUP2, YDR172W, YD9395.05

 

FUNCTION:
 
Involved in translation termination. Stimulates the activity of ERF1. Binds guanine nucleotides. Recruited by polyadenylate-binding protein PAB1 to poly(A)-tails of mRNAs. Interaction with PAB1 is also required for regulation of normal mRNA decay through translation termination-coupled poly(A) shortening. 
 
SUBUNIT STRUCTURE:
 
Heterodimer of two subunits, one of which binds GTP. Interacts with polyadenylate-binding protein PAB1, and TPA1. 
 
CELLULAR LOCALIZATION:
 
Cytoplasm (Probable.)
 
DOMAIN: 
 
The prion domain (PrD) is a Gln/Asn (Q/N)-rich domain, which is unstructured in its native, soluble form, and which forms a parallel in-register beta-sheet in its amyloid form.



Activities in which Eukaryotic peptide chain release factor GTP-binding subunit is involved: Pathways in which Eukaryotic peptide chain release factor GTP-binding subunit is involved:

NCBI GI number(s): 6320377
296143522
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P05453 P05453
BRENDA - -
KEGG sce:YDR172W sce:YDR172W
PFAM: PF00009
PF03144
PF03143
PF00009
PF03144
PF03143
InterPro: IPR000795
IPR009001
IPR004161
IPR004160
IPR009000
IPR003285
IPR000795
IPR009001
IPR004161
IPR004160
IPR009000
IPR003285
CATH: - -
SCOP: - -
Solved crystal structures: 1YJP
1YJO
[PDB] [details]
[PDB] [details]


Protein sequence:
MSDSNQGNNQQNYQQYSQNGNQQQGNNRYQGYQAYNAQAQPAGGYYQNYQ
GYSGYQQGGYQQYNPDAGYQQQYNPQGGYQQYNPQGGYQQQFNPQGGRGN
YKNFNYNNNLQGYQAGFQPQSQGMSLNDFQKQQKQAAPKPKKTLKLVSSS
GIKLANATKKVGTKPAESDKKEEEKSAETKEPTKEPTKVEEPVKKEEKPV
QTEEKTEEKSELPKVEDLKISESTHNTNNANVTSADALIKEQEEEVDDEV
VNDMFGGKDHVSLIFMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAK
DAGRQGWYLSWVMDTNKEERNDGKTIEVGKAYFETEKRRYTILDAPGHKM
YVSEMIGGASQADVGVLVISARKGEYETGFERGGQTREHALLAKTQGVNK
MVVVVNKMDDPTVNWSKERYDQCVSNVSNFLRAIGYNIKTDVVFMPVSGY
SGANLKDHVDPKECPWYTGPTLLEYLDTMNHVDRHINAPFMLPIAAKMKD
LGTIVEGKIESGHIKKGQSTLLMPNKTAVEIQNIYNETENEVDMAMCGEQ
VKLRIKGVEEEDISPGFVLTSPKNPIKSVTKFVAQIAIVELKSIIAAGFS
CVMHVHTAIEEVHIVKLLHKLEKGTNRKSKKPPAFAKKGMKVIAVLETEA
PVCVETYQDYPQLGRFTLRDQGTTIAIGKIVKIAE

Eukaryotic peptide chain release factor GTP-binding subunit (Saccharomyces cerevisiae) is product of expression of SUP35 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature 1997-05-01 (387) 9169867
Translation termination factor eRF3 mediates mRNA decay through the regulation of deadenylation. Hosoda N, Kobayashi T, Uchida N, Funakoshi Y, Kikuchi Y, Hoshino S, Katada T J Biol Chem 2003-10-03 (278) 12923185
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP J Proteome Res 2007-03-01 (6) 17330950
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Nucleotide sequence of the SUP2 (SUP35) gene of Saccharomyces cerevisiae. Kushnirov VV, Ter-Avanesyan MD, Telckov MV, Surguchov AP, Smirnov VN, Inge-Vechtomov SG Gene 1988-06-15 (66) 3047009
Localization of possible functional domains in sup2 gene product of the yeast Saccharomyces cerevisiae. Kushnirov VV, Ter-Avanesyan MD, Surguchov AP, Smirnov VN, Inge-Vechtomov SG FEBS Lett 1987-05-11 (215) 3556215
SUF12 suppressor protein of yeast. A fusion protein related to the EF-1 family of elongation factors. Wilson PG, Culbertson MR J Mol Biol 1988-01-20 (199) 3280807
A yeast gene required for the G1-to-S transition encodes a protein containing an A-kinase target site and GTPase domain. Kikuchi Y, Shimatake H, Kikuchi A EMBO J 1988-04-01 (7) 2841115
The products of the SUP45 (eRF1) and SUP35 genes interact to mediate translation termination in Saccharomyces cerevisiae. Stansfield I, Jones KM, Kushnirov VV, Dagkesamanskaya AR, Poznyakovski AI, Paushkin SV, Nierras CR, Cox BS, Ter-Avanesyan MD, Tuite MF EMBO J 1995-09-01 (14) 7556078
Propagation of the yeast prion-like [psi+] determinant is mediated by oligomerization of the SUP35-encoded polypeptide chain release factor. Paushkin SV, Kushnirov VV, Smirnov VN, Ter-Avanesyan MD EMBO J 1996-06-17 (15) 8670813
Genesis and variability of [PSI] prion factors in Saccharomyces cerevisiae. Derkatch IL, Chernoff YO, Kushnirov VV, Inge-Vechtomov SG, Liebman SW Genetics 1996-12-01 (144) 8978027
Genetic and environmental factors affecting the de novo appearance of the [PSI+] prion in Saccharomyces cerevisiae. Derkatch IL, Bradley ME, Zhou P, Chernoff YO, Liebman SW Genetics 1997-10-01 (147) 9335589
Prions affect the appearance of other prions: the story of [PIN(+)]. Derkatch IL, Bradley ME, Hong JY, Liebman SW Cell 2001-07-27 (106) 11511345
Poly(A)-binding protein acts in translation termination via eukaryotic release factor 3 interaction and does not influence [PSI(+)] propagation. Cosson B, Couturier A, Chabelskaya S, Kiktev D, Inge-Vechtomov S, Philippe M, Zhouravleva G Mol Cell Biol 2002-05-01 (22) 11971964
The GTP-binding release factor eRF3 as a key mediator coupling translation termination to mRNA decay. Kobayashi T, Funakoshi Y, Hoshino S, Katada T J Biol Chem 2004-10-01 (279) 15337765
Protein-only transmission of three yeast prion strains. King CY, Diaz-Avalos R Nature 2004-03-18 (428) 15029195
Conformational variations in an infectious protein determine prion strain differences. Tanaka M, Chien P, Naber N, Cooke R, Weissman JS Nature 2004-03-18 (428) 15029196
A faux 3'-UTR promotes aberrant termination and triggers nonsense-mediated mRNA decay. Amrani N, Ganesan R, Kervestin S, Mangus DA, Ghosh S, Jacobson A Nature 2004-11-04 (432) 15525991
Tpa1p is part of an mRNP complex that influences translation termination, mRNA deadenylation, and mRNA turnover in Saccharomyces cerevisiae. Keeling KM, Salas-Marco J, Osherovich LZ, Bedwell DM Mol Cell Biol 2006-07-01 (26) 16809762
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A 2007-06-19 (104) 17563356
The spontaneous appearance rate of the yeast prion [PSI+] and its implications for the evolution of the evolvability properties of the [PSI+] system. Lancaster AK, Bardill JP, True HL, Masel J Genetics 2010-01-01 (184) 19917766
Structure of the cross-beta spine of amyloid-like fibrils. Nelson R, Sawaya MR, Balbirnie M, Madsen AO, Riekel C, Grothe R, Eisenberg D Nature 2005-06-09 (435) 15944695
Amyloid of the prion domain of Sup35p has an in-register parallel beta-sheet structure. Shewmaker F, Wickner RB, Tycko R Proc Natl Acad Sci U S A 2006-12-26 (103) 17170131



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.