Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

ATP-dependent helicase NAM7

 
Known also as: Nonsense-mediated mRNA decay protein 1,Nuclear accommodation of mitochondria 7 protein,Up-frameshift suppressor 1

Known abbreviations: NAM7, IFS2, MOF4, UPF1, YMR080C, YM9582.05C

 

FUNCTION:
 
Probable helicase involved in mitochondrial functions. Required for rapid turnover of mRNAs containing a premature translational termination codon.
 
CELLULAR LOCALIZATION:
 
Cytoplasm. Nucleus. Note: Present predominantly in the cytoplasm, but is also found in small quantities in the nucleus.



Activities in which ATP-dependent helicase NAM7 is involved: Pathways in which ATP-dependent helicase NAM7 is involved:

NCBI GI number(s): 6323726
6323726
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P30771 P30771
BRENDA - -
KEGG sce:YMR080 sce:YMR080
PFAM: PF09416
PF09416
InterPro: IPR003593
IPR014001
IPR018999
IPR003593
IPR014001
IPR018999
CATH: - -
SCOP: - -
Solved crystal structures: 2XZL
[PDB] [details]


Protein sequence:
MVGSGSHTPYDISNSPSDVNVQPATQLNSTLVEDDDVDNQLFEEAQVTET
GFRSPSASDNSCAYCGIDSAKCVIKCNSCKKWFCNTKNGTSSSHIVNHLV
LSHHNVVSLHPDSDLGDTVLECYNCGRKNVFLLGFVSAKSEAVVVLLCRI
PCAQTKNANWDTDQWQPLIEDRQLLSWVAEQPTEEEKLKARLITPSQISK
LEAKWRSNKDATINDIDAPEEQEAIPPLLLRYQDAYEYQRSYGPLIKLEA
DYDKQLKESQALEHISVSWSLALNNRHLASFTLSTFESNELKVAIGDEMI
LWYSGMQHPDWEGRGYIVRLPNSFQDTFTLELKPSKTPPPTHLTTGFTAE
FIWKGTSYDRMQDALKKFAIDKKSISGYLYYKILGHQVVDISFDVPLPKE
FSIPNFAQLNSSQSNAVSHVLQRPLSLIQGPPGTGKTVTSATIVYHLSKI
HKDRILVCAPSNVAVDHLAAKLRDLGLKVVRLTAKSREDVESSVSNLALH
NLVGRGAKGELKNLLKLKDEVGELSASDTKRFVKLVRKTEAEILNKADVV
CCTCVGAGDKRLDTKFRTVLIDESTQASEPECLIPIVKGAKQVILVGDHQ
QLGPVILERKAADAGLKQSLFERLISLGHVPIRLEVQYRMNPYLSEFPSN
MFYEGSLQNGVTIEQRTVPNSKFPWPIRGIPMMFWANYGREEISANGTSF
LNRIEAMNCERIITKLFRDGVKPEQIGVITPYEGQRAYILQYMQMNGSLD
KDLYIKVEVASVDAFQGREKDYIILSCVRANEQQAIGFLRDPRRLNVGLT
RAKYGLVILGNPRSLARNTLWNHLLIHFREKGCLVEGTLDNLQLCTVQLV
RPQPRKTERPMNAQFNVESEMGDFPKFQDFDAQSMVSFSGQIGDFGNAFV
DNTELSSYINNEYWNFENFKSAFSQKQNRNEIDDRNLYQEEASHLNSNFA
RELQREEQKHELSKDFSNLGI

ATP-dependent helicase NAM7 (Saccharomyces cerevisiae) is product of expression of NAM7 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII. Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B Nature 1997-05-01 (387) 9169872
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
NAM7 nuclear gene encodes a novel member of a family of helicases with a Zn-ligand motif and is involved in mitochondrial functions in Saccharomyces cerevisiae. Altamura N, Groudinsky O, Dujardin G, Slonimski PP J Mol Biol 1992-04-05 (224) 1314899
Gene products that promote mRNA turnover in Saccharomyces cerevisiae. Leeds P, Wood JM, Lee BS, Culbertson MR Mol Cell Biol 1992-05-01 (12) 1569946
Mof4-1 is an allele of the UPF1/IFS2 gene which affects both mRNA turnover and -1 ribosomal frameshifting efficiency. Cui Y, Dinman JD, Peltz SW EMBO J 1996-10-15 (15) 8896465
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP J Proteome Res 2007-03-01 (6) 17330950
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.