Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Nonsense-mediated mRNA decay protein 2

 
Known also as: Up-frameshift suppressor 2

Known abbreviations: NMD2, IFS1, SUA1, UPF2, YHR077C

 

FUNCTION:
 
Involved in nonsense-mediated decay of mRNAs containing premature stop codons. It interacts, via its C-terminus, with NAM7/UPF1. Could be involved in determining the efficiency of translational termination or reinitiation or factors involved in the initial assembly of an initiation- and termination-competent mRNP.
 
CELLULAR LOCALIZATION:
 
Cytoplasm (Potential)



Activities in which Nonsense-mediated mRNA decay protein 2 is involved: Pathways in which Nonsense-mediated mRNA decay protein 2 is involved:

NCBI GI number(s): 6579193
296145455
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P38798 P38798
BRENDA - -
KEGG sce:YHR077C sce:YHR077C
PFAM: PF02854
PF04050
PF02854
PF04050
InterPro: IPR016024
IPR016021
IPR003890
IPR007193
IPR016024
IPR016021
IPR003890
IPR007193
CATH: - -
SCOP: - -


Protein sequence:
MDDGRKKELHDLNTRAWNGEEVFPLKSKKLDSSIKRNTGFIKKLKKGFVK
GSESSLLKDLSEASLEKYLSEIIVTVTECLLNVLNKNDDVIAAVEIISGL
HQRFNGRFTSPLLGAFLQAFENPSVDIESERDELQRITRVKGNLRVFTEL
YLVGVFRTLDDIESKDAIPNFLQKKTGRKDPLLFSILREILNYKFKLGFT
TTIATAFIKKFAPLFRDDDNSWDDLIYDSKLKGALQSLFKNFIDATFARA
TELHKKVNKLQREHQKCQIRTGKLRDEYVEEYDKLLPIFIRFKTSAITLG
EFFKLEIPELEGASNDDLKETASPMITNQILPPNQRLWENEDTRKFYEIL
PDISKTVEESQSSKTEKDSNVNSKNINLFFTDLEMADCKDIIDDLSNRYW
SSYLDNKATRNRILKFFMETQDWSKLPVYSRFIATNSKYMPEIVSEFINY
LDNGFRSQLHSNKINVKNIIFFSEMIKFQLIPSFMIFHKIRTLIMYMQVP
NNVEILTVLLEHSGKFLLNKPEYKELMEKMVQLIKDKKNDRQLNMNMKSA
LENIITLLYPPSVKSLNVTVKTITPEQQFYRILIRSELSSLDFKHIVKLV
RKAHWDDVAIQKVLFSLFSKPHKISYQNIPLLTKVLGGLYSYRRDFVIRC
IDQVLENIERGLEINDYGQNMHRISNVRYLTEIFNFEMIKSDVLLDTIYH
IIRFGHINNQPNPFYLNYSDPPDNYFRIQLVTTILLNINRTPAAFTKKCK
LLLRFFEYYTFIKEQPLPKETEFRVSSTFKKYENIFGNTKFERSENLVES
ASRLESLLKSLNAIKSKDDRVKGSSASIHNGKESAVPIESITEDDEDEDD
ENDDGVDLLGEDEDAEISTPNTESAPGKHQAKQDESEDEDDEDDDEDDDD
DDDDDDDDGEEGDEDDDEDDDDEDDDDEEEEDSDSDLEYGGDLDADRDIE
MKRMYEEYERKLKDEEERKAEEELERQFQKMMQESIDARKSEKVVASKIP
VISKPVSVQKPLLLKKSEEPSSSKETYEELSKPKKIAFTFLTKSGKKTQS
RILQLPTDVKFVSDVLEEEEKLKTERNKIKKIVLKRSFD

Nonsense-mediated mRNA decay protein 2 (Saccharomyces cerevisiae) is product of expression of NMD2 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII. Johnston M, Andrews S, Brinkman R, Cooper J, Ding H, Dover J, Du Z, Favello A, Fulton L, Gattung S, et al. Science 1994-09-01 (265) 8091229
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Identification of a novel component of the nonsense-mediated mRNA decay pathway by use of an interacting protein screen. He F, Jacobson A Genes Dev 1995-01-15 (9) 7883168
Identification and characterization of genes that are required for the accelerated degradation of mRNAs containing a premature translational termination codon. Cui Y, Hagan KW, Zhang S, Peltz SW Genes Dev 1995-01-15 (9) 7883167
A genetic screen identifies cellular factors involved in retroviral -1 frameshifting. Lee SI, Umen JG, Varmus HE Proc Natl Acad Sci U S A 1995-07-03 (92) 7604038



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.