Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Nonsense-mediated mRNA decay protein 3

 
Known also as: Up-frameshift suppressor 3

Known abbreviations: UPF3, SUA6, YGR072W

 

FUNCTION:
 
Involved in nonsense-mediated decay of mRNAs containing premature stop codons.
 
CELLULAR LOCALIZATION:
 
Nucleus



Activities in which Nonsense-mediated mRNA decay protein 3 is involved: Pathways in which Nonsense-mediated mRNA decay protein 3 is involved:

NCBI GI number(s): 6321509
296145105
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P48412 P48412
BRENDA - -
KEGG sce:YGR072W sce:YGR072W
PFAM: PF03467
PF03467
InterPro: IPR005120
IPR012677
IPR005120
IPR012677
CATH: - -
SCOP: - -


Protein sequence:
MSNVAGELKNSEGKKKGRGNRYHNKNRGKSKNETVDPKKNENKVNNATNA
THNNSKGRRNNKKRNREYYNYKRKARLGKSTENEGFKLVIRLLPPNLTAD
EFFAILRDNNNDDGDKQDIQGKLKYSDWCFFEGHYSSKVFKNSTYSRCNF
LFDNLSDLEKCANFIKTCKFIDNKDNITIPDMKLSPYVKKFTQTSKKDAA
LVGTIEEDEIFKTFMNSMKQLNENDEYSFQDFSVLKSLEKEFSKSIELEN
KIAERTERVLTELVGTGDKVKNKNKKKKNKNAKKKFKEEEASAKIPKKKR
NRGKKKRENREKSTISKTKNSNVVIIEEAGKEVLKQRKKKMLLQEKLKIS
NSSQPQSSSAQTQPSFQPKENLFVPRVKILHRDDTKK

Nonsense-mediated mRNA decay protein 3 (Saccharomyces cerevisiae) is product of expression of UPF3 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of Saccharomyces cerevisiae chromosome VII. Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K Nature 1997-05-01 (387) 9169869
Identification of an additional gene required for eukaryotic nonsense mRNA turnover. Lee BS, Culbertson MR Proc Natl Acad Sci U S A 1995-10-24 (92) 7479783
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Yeast mitochondrial dehydrogenases are associated in a supramolecular complex. Grandier-Vazeille X, Bathany K, Chaignepain S, Camougrand N, Manon S, Schmitter JM Biochemistry 2001-08-21 (40) 11502169
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.