Welcome! Click here to login or here to register.
 |
||||||||||||||||||
|
||||||||||||||||||
 |
||||||||||||||||||
mRNA-capping enzyme |
|
|
FUNCTION:
Bifunctional mRNA-capping enzyme exhibiting RNA 5'-triphosphatase activity in the N-terminal part and mRNA guanylyltransferase activity in the C-terminal part. Catalyzes the first two steps of cap formation: by removing the gamma-phosphate from the 5'-triphosphate end of nascent mRNA to yield a diphosphate end, and by transferring the gmp moiety of GTP to the 5'-diphosphate terminus.
CATALYTIC ACTIVITY:
A 5'-phosphopolynucleotide + H2O = a polynucleotide + phosphate.
GTP + (5')pp-Pur-mRNA = diphosphate + G(5')ppp-Pur-mRNA.
SUBUNIT STRUCTURE:
Interacts with SUPT5H and RNMT. Interacts with HIV-1 Tat.
CELLULAR LOCALIZATION:
Nucleus
|
Activities in which mRNA-capping enzyme is involved:
- Hydrolysis of the 5' end of the nascent transcript by the capping enzyme in Homo sapiens [reaction id: 196]
- Transfer of GMP from the capping enzyme GT site to 5'-end of mRNA in Homo sapiens [reaction id: 197]
- Recognition of the 5' end of the nascent transcript by the capping enzyme in Homo sapiens [reaction id: 237]
| NCBI GI number(s): |
134142828 134142827 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
|---|---|---|
| Uniprot | O60942 | O60942 |
| BRENDA | - | - |
| KEGG | hsa:8732 | hsa:8732 |
| PFAM: |
PF00782 PF03919 PF01331 |
PF00782 PF03919 PF01331 |
| InterPro: |
IPR000340 IPR017074 IPR001339 IPR013846 IPR012340 IPR016027 IPR000387 IPR016130 |
IPR000340 IPR017074 IPR001339 IPR013846 IPR012340 IPR016027 IPR000387 IPR016130 |
| CATH: | - | - |
| SCOP: | - | - |
| Solved crystal structures: |
3S24 2C46 |
[PDB]
[details] [PDB] [details] |
Protein sequence:
|
MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSML SNYLKSLKVKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTT ENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIE AAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDEDE DEDEDGKKESEPGSSASFGKRRKERLKLGAIFLEGVTVKGVTQVTTQPKL GEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRY MMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDR VNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGL IDKTQEPFSVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGKYKP GRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQ IKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSIS NPVTKEMLFEFIDRCTAASQGQKRKHHLDPDTELMPPPPPKRPRPLT |
MRNA-capping enzyme (Homo sapiens) is product of expression of RNGTT gene.
References:
| Title | Authors | Journal | Publication date (Issue) | PubMed ID |
|---|---|---|---|---|
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K | Genome Res | 2004-10-01 (14) | 15489334 |
| Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. | Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M | Cell | 2006-11-03 (127) | 17081983 |
| The DNA sequence and analysis of human chromosome 6. | Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE | Nature | 2003-10-23 (425) | 14574404 |
| Recombinant human mRNA cap methyltransferase binds capping enzyme/RNA polymerase IIo complexes. | Pillutla RC, Yue Z, Maldonado E, Shatkin AJ | J Biol Chem | 1998-08-21 (273) | 9705270 |
| Mammalian capping enzyme complements mutant Saccharomyces cerevisiae lacking mRNA guanylyltransferase and selectively binds the elongating form of RNA polymerase II. | Yue Z, Maldonado E, Pillutla R, Cho H, Reinberg D, Shatkin AJ | Proc Natl Acad Sci U S A | 1997-11-25 (94) | 9371772 |
| Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme. | Yamada-Okabe T, Doi R, Shimmi O, Arisawa M, Yamada-Okabe H | Nucleic Acids Res | 1998-04-01 (26) | 9512541 |
| Cloning and characterization of two human cDNAs encoding the mRNA capping enzyme. | Tsukamoto T, Shibagaki Y, Murakoshi T, Suzuki M, Nakamura A, Gotoh H, Mizumoto K | Biochem Biophys Res Commun | 1998-01-04 (243) | 9473487 |
| Transcription elongation factor hSPT5 stimulates mRNA capping. | Wen Y, Shatkin AJ | Genes Dev | 1999-07-15 (13) | 10421630 |
| HIV-1 Tat protein interacts with mammalian capping enzyme and stimulates capping of TAR RNA. | Chiu YL, Coronel E, Ho CK, Shuman S, Rana TM | J Biol Chem | 2001-04-20 (276) | 11278368 |
Add your own comment!
There are no comments yet.
Last modification of this entry: Sept. 25, 2012.
Copyright © Genesilico - All rights reserved