Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

mRNA-capping enzyme

 
Known abbreviations: HCAP1, HCE, RNGTT, CAP1A

 

FUNCTION:
 
Bifunctional mRNA-capping enzyme exhibiting RNA 5'-triphosphatase activity in the N-terminal part and mRNA guanylyltransferase activity in the C-terminal part. Catalyzes the first two steps of cap formation: by removing the gamma-phosphate from the 5'-triphosphate end of nascent mRNA to yield a diphosphate end, and by transferring the gmp moiety of GTP to the 5'-diphosphate terminus.
 
CATALYTIC ACTIVITY:
 
A 5'-phosphopolynucleotide + H2O = a polynucleotide + phosphate.
GTP + (5')pp-Pur-mRNA = diphosphate + G(5')ppp-Pur-mRNA.
 
SUBUNIT STRUCTURE:
 
Interacts with SUPT5H and RNMT. Interacts with HIV-1 Tat. 
 
CELLULAR LOCALIZATION:
 
Nucleus



Activities in which mRNA-capping enzyme is involved: Pathways in which mRNA-capping enzyme is involved:

NCBI GI number(s): 134142828
134142827
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot O60942 O60942
BRENDA - -
KEGG hsa:8732 hsa:8732
PFAM: PF00782
PF03919
PF01331
PF00782
PF03919
PF01331
InterPro: IPR000340
IPR017074
IPR001339
IPR013846
IPR012340
IPR016027
IPR000387
IPR016130
IPR000340
IPR017074
IPR001339
IPR013846
IPR012340
IPR016027
IPR000387
IPR016130
CATH: - -
SCOP: - -
Solved crystal structures: 3S24
2C46
[PDB] [details]
[PDB] [details]


Protein sequence:
MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSML
SNYLKSLKVKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTT
ENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIE
AAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDEDE
DEDEDGKKESEPGSSASFGKRRKERLKLGAIFLEGVTVKGVTQVTTQPKL
GEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRY
MMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDR
VNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGL
IDKTQEPFSVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGKYKP
GRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQ
IKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSIS
NPVTKEMLFEFIDRCTAASQGQKRKHHLDPDTELMPPPPPKRPRPLT

MRNA-capping enzyme (Homo sapiens) is product of expression of RNGTT gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M Cell 2006-11-03 (127) 17081983
The DNA sequence and analysis of human chromosome 6. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE Nature 2003-10-23 (425) 14574404
Recombinant human mRNA cap methyltransferase binds capping enzyme/RNA polymerase IIo complexes. Pillutla RC, Yue Z, Maldonado E, Shatkin AJ J Biol Chem 1998-08-21 (273) 9705270
Mammalian capping enzyme complements mutant Saccharomyces cerevisiae lacking mRNA guanylyltransferase and selectively binds the elongating form of RNA polymerase II. Yue Z, Maldonado E, Pillutla R, Cho H, Reinberg D, Shatkin AJ Proc Natl Acad Sci U S A 1997-11-25 (94) 9371772
Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme. Yamada-Okabe T, Doi R, Shimmi O, Arisawa M, Yamada-Okabe H Nucleic Acids Res 1998-04-01 (26) 9512541
Cloning and characterization of two human cDNAs encoding the mRNA capping enzyme. Tsukamoto T, Shibagaki Y, Murakoshi T, Suzuki M, Nakamura A, Gotoh H, Mizumoto K Biochem Biophys Res Commun 1998-01-04 (243) 9473487
Transcription elongation factor hSPT5 stimulates mRNA capping. Wen Y, Shatkin AJ Genes Dev 1999-07-15 (13) 10421630
HIV-1 Tat protein interacts with mammalian capping enzyme and stimulates capping of TAR RNA. Chiu YL, Coronel E, Ho CK, Shuman S, Rana TM J Biol Chem 2001-04-20 (276) 11278368



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.