Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

mRNA cap guanine-N7 methyltransferase

 
Known also as: mRNA (guanine-N(7)-)-methyltransferase, mRNA cap methyltransferase

Known abbreviations: RG7MT1, hcm1p, hMet, hCMT1, RNMT, KIAA0398

 

FUNCTION:
 
mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. Binds RNA containing 5'-terminal GpppC. 
 
CATALYTIC ACTIVITY:
 
S-adenosyl-L-methionine + G(5')pppR-RNA = S-adenosyl-L-homocysteine + m7G(5')pppR-RNA.
 
SUBUNIT STRUCTURE:
 
Interacts with importin alpha, leading to stimulate both RNA-binding and methyltransferase activity. Interaction with importin alpha and beta is required for its nuclear localization, importin beta dissociating in response to RanGTP, allowing RNMT-importin alpha to bind RNA substrates. Interacts with elongating form of polymerase II and RNGTT. Interacts with RAM/FAM103A1, the interaction significantly enhances RNA-binding and cap methyltransferase activity. 
 
CELLULAR LOCALIZATION:
 
Nucleus



Activities in which mRNA cap guanine-N7 methyltransferase is involved: Pathways in which mRNA cap guanine-N7 methyltransferase is involved:

NCBI GI number(s): 4506567
4506566
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot O43148 O43148
BRENDA - -
KEGG hsa:8731 hsa:8731
PFAM: PF03291
PF03291
InterPro: IPR016899
IPR004971
IPR016899
IPR004971
CATH: - -
SCOP: - -
Solved crystal structures: 3EPP
3BGV
[PDB] [details]
[PDB] [details]


Protein sequence:
MANSAKAEEYEKMSLEQAKASVNSETESSFNINENTTASGTGLSEKTSVC
RQVDIARKRKEFEDDLVKESSSCGKDTPSKKRKLDPEIVPEEKDCGDAEG
NSKKRKRETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVA
AHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDIT
VLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSE
YIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMM
LRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGD
YPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYE
EKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVR
LPLGTLSKSEWEATSIYLVFAFEKQQ

MRNA cap guanine-N7 methyltransferase (Homo sapiens) is product of expression of RNMT gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro. Ishikawa K, Nagase T, Nakajima D, Seki N, Ohira M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O DNA Res 1997-10-31 (4) 9455477
Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase. Tsukamoto T, Shibagaki Y, Niikura Y, Mizumoto K Biochem Biophys Res Commun 1998-10-09 (251) 9790902
Recombinant human mRNA cap methyltransferase binds capping enzyme/RNA polymerase IIo complexes. Pillutla RC, Yue Z, Maldonado E, Shatkin AJ J Biol Chem 1998-08-21 (273) 9705270
The Candida albicans gene for mRNA 5-cap methyltransferase: identification of additional residues essential for catalysis. Yamada-Okabe T, Mio T, Kashima Y, Matsui M, Arisawa M, Yamada-Okabe H Microbiology 1999-11-01 (None) 10589710
Characterization of human, Schizosaccharomyces pombe, and Candida albicans mRNA cap methyltransferases and complete replacement of the yeast capping apparatus by mammalian enzymes. Saha N, Schwer B, Shuman S J Biol Chem 1999-06-04 (274) 10347220
Cap methyltransferase selective binding and methylation of GpppG-RNA are stimulated by importin-alpha. Wen Y, Shatkin AJ Genes Dev 2000-12-01 (14) 11114884
Human mRNA cap methyltransferase: alternative nuclear localization signal motifs ensure nuclear localization required for viability. Shafer B, Chu C, Shatkin AJ Mol Cell Biol 2005-04-01 (25) 15767670
RAM/Fam103a1 is required for mRNA cap methylation. Gonatopoulos-Pournatzis T, Dunn S, Bounds R, Cowling VH Mol Cell 2011-11-18 (44) 22099306



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.