Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

mRNA cap guanine-N7 methyltransferase

 
Known also as: mRNA (guanine-N(7)-)-methyltransferase, mRNA cap methyltransferase

Known abbreviations: ABD1, YBR236C, YBR1602

 

FUNCTION:
 
Responsible for methylating the 5'-cap structure of mRNAs. 
 
CATALYTIC ACTIVITY:
 
S-adenosyl-L-methionine + G(5')pppR-RNA = S-adenosyl-L-homocysteine + m7G(5')pppR-RNA.
 
CELLULAR LOCALIZATION:
 
Nucleus 



Activities in which mRNA cap guanine-N7 methyltransferase is involved: Pathways in which mRNA cap guanine-N7 methyltransferase is involved:

NCBI GI number(s): 398365663
398365662
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P32783 P32783
BRENDA - -
KEGG sce:YBR236C sce:YBR236C
PFAM: PF03291
PF03291
InterPro: IPR016899
IPR004971
IPR016899
IPR004971
CATH: - -
SCOP: - -
Solved crystal structures: 1IC3
[PDB] [details]


Protein sequence:
MSTKPEKPIWMSQEDYDRQYGSITGDESSTVSKKDSKVTANAPGDGNGSL
PVLQSSSILTSKVSDLPIEAESGFKIQKRRHERYDQEERLRKQRAQKLRE
EQLKRHEIEMTANRSINVDQIVREHYNERTIIANRAKRNLSPIIKLRNFN
NAIKYMLIDKYTKPGDVVLELGCGKGGDLRKYGAAGISQFIGIDISNASI
QEAHKRYRSMRNLDYQVVLITGDCFGESLGVAVEPFPDCRFPCDIVSTQF
CLHYAFETEEKARRALLNVAKSLKIGGHFFGTIPDSEFIRYKLNKFPKEV
EKPSWGNSIYKVTFENNSYQKNDYEFTSPYGQMYTYWLEDAIDNVPEYVV
PFETLRSLADEYGLELVSQMPFNKFFVQEIPKWIERFSPKMREGLQRSDG
RYGVEGDEKEAASYFYTMFAFRKVKQYIEPESVKPN

MRNA cap guanine-N7 methyltransferase (Saccharomyces cerevisiae) is product of expression of ABD1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Complete DNA sequence of yeast chromosome II. Feldmann H, Aigle M, Aljinovic G, Andre B, Baclet MC, Barthe C, Baur A, Becam AM, Biteau N, Boles E, Brandt T, Brendel M, Bruckner M, Bussereau F, Christiansen C, Contreras R, Crouzet M, Cziepluch C, Demolis N, Delaveau T, Doignon F, Domdey H, Dusterhus S, Dubois E, Dujon B, El Bakkoury M, Entian KD EMBO J 1994-12-15 (13) 7813418
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Yeast mRNA cap methyltransferase is a 50-kilodalton protein encoded by an essential gene. Mao X, Schwer B, Shuman S Mol Cell Biol 1995-08-01 (15) 7623811
Mutational analysis of the Saccharomyces cerevisiae ABD1 gene: cap methyltransferase activity is essential for cell growth. Mao X, Schwer B, Shuman S Mol Cell Biol 1996-01-01 (16) 8552073
Structure-function analysis of the mRNA cap methyltransferase of Saccharomyces cerevisiae. Wang SP, Shuman S J Biol Chem 1997-06-06 (272) 9169431
Dynamic association of capping enzymes with transcribing RNA polymerase II. Schroeder SC, Schwer B, Shuman S, Bentley D Genes Dev 2000-10-01 (14) 11018011
mRNA:guanine-N7 cap methyltransferases: identification of novel members of the family, evolutionary analysis, homology modeling, and analysis of sequence-structure-function relationships. Bujnicki JM, Feder M, Radlinska M, Rychlewski L BMC Bioinformatics 2001-01-01 (2) 11472630



Add your own comment!


There are no comments yet.

Last modification of this entry: April 16, 2013.

Welcome stranger! Click here to login or here to register.