Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

mRNA-capping enzyme subunit alpha

 
Known also as: GTP--RNA guanylyltransferase, mRNA guanylyltransferase

Known abbreviations: GTase, CEG1, YGL130W, G2853

 

FUNCTION:
 
Second step of mRNA capping. Transfer of the GMP moiety of GTP to the 5'-end of RNA via an enzyme-GMP covalent reaction intermediate.
 
CATALYTIC ACTIVITY:
 
GTP + (5')pp-Pur-mRNA = diphosphate + G(5')ppp-Pur-mRNA.
 
COFACTOR:
 
Divalent ions.
 
SUBUNIT STRUCTURE:
 
The mRNA-capping enzyme is composed of two separate chains alpha and beta, respectively a mRNA guanylyltransferase and an RNA 5'-triphosphatase.
 
CELLULAR LOCALIZATION:
 
Nucleus.



Activities in which mRNA-capping enzyme subunit alpha is involved: Pathways in which mRNA-capping enzyme subunit alpha is involved:

NCBI GI number(s): 392860210
392860209
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q01159 Q01159
BRENDA - -
KEGG sce:YGL130W sce:YGL130W
PFAM: PF03919
PF01331
PF03919
PF01331
InterPro: IPR001339
IPR013846
IPR017075
IPR012340
IPR016027
IPR001339
IPR013846
IPR017075
IPR012340
IPR016027
CATH: - -
SCOP: - -
Solved crystal structures: 3KYH
[PDB] [details]


Protein sequence:
MVLAMESRVAPEIPGLIQPGNVTQDLKMMVCKLLNSPKPTKTFPGSQPVS
FQHSDVEEKLLAHDYYVCEKTDGLRVLMFIVINPVTGEQGCFMIDRENNY
YLVNGFRFPRLPQKKKEELLETLQDGTLLDGELVIQTNPMTKLQELRYLM
FDCLAINGRCLTQSPTSSRLAHLGKEFFKPYFDLRAAYPNRCTTFPFKIS
MKHMDFSYQLVKVAKSLDKLPHLSDGLIFTPVKAPYTAGGKDSLLLKWKP
EQENTVDFKLILDIPMVEDPSLPKDDRNRWYYNYDVKPVFSLYVWQGGAD
VNSRLKHFDQPFDRKEFEILERTYRKFAELSVSDEEWQNLKNLEQPLNGR
IVECAKNQETGAWEMLRFRDDKLNGNHTSVVQKVLESINDSVSLEDLEEI
VGDIKRCWDERRANMAGGSGRPLPSQSQNATLSTSKPVHSQPPSNDKEPK
YVDEDDWSD

MRNA-capping enzyme subunit alpha (Saccharomyces cerevisiae) is product of expression of CEG1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of Saccharomyces cerevisiae chromosome VII. Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K Nature 1997-05-01 (387) 9169869
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
mRNA capping enzyme. Isolation and characterization of the gene encoding mRNA guanylytransferase subunit from Saccharomyces cerevisiae. Shibagaki Y, Itoh N, Yamada H, Nagata S, Mizumoto K J Biol Chem 1992-05-15 (267) 1315757
Isolation of temperature-sensitive mutants for mRNA capping enzyme in Saccharomyces cerevisiae. Yamagishi M, Mizumoto K, Ishihama A Mol Gen Genet 1995-11-15 (249) 7500935
Sequence analysis of a 10 kb DNA fragment from yeast chromosome VII reveals a novel member of the DnaJ family. Rodriguez-Belmonte E, Rodriguez-Torres AM, Tizon B, Cadahia JL, Gonzalez-Siso I, Ramil E, Becerra M, Gonzalez-Dominguez M, Cerdan E Yeast 1996-01-01 (12) 8686378
Covalent catalysis in nucleotidyl transfer reactions: essential motifs in Saccharomyces cerevisiae RNA capping enzyme are conserved in Schizosaccharomyces pombe and viral capping enzymes and among polynucleotide ligases. Shuman S, Liu Y, Schwer B Proc Natl Acad Sci U S A 1994-12-06 (91) 7991582
Active site of the mRNA-capping enzyme guanylyltransferase from Saccharomyces cerevisiae: similarity to the nucleotidyl attachment motif of DNA and RNA ligases. Fresco LD, Buratowski S Proc Natl Acad Sci U S A 1994-07-05 (91) 8022828
Messenger RNA guanylyltransferase from Saccharomyces cerevisiae. I. Purification and subunit structure. Itoh N, Mizumoto K, Kaziro Y J Biol Chem 1984-11-25 (259) 6389537
Messenger RNA guanlyltransferase from Saccharomyces cerevisiae. II. Catalytic properties. Itoh N, Mizumoto K, Kaziro Y J Biol Chem 1984-11-25 (259) 6094533
Messenger RNA guanylyltransferase from Saccharomyces cerevisiae. Large scale purification, subunit functions, and subcellular localization. Itoh N, Yamada H, Kaziro Y, Mizumoto K J Biol Chem 1987-01-15 (262) 3029058



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.