Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Polyribonucleotide nucleotidyltransferase

 
Known also as: Polynucleotide phosphorylase

Known abbreviations: PNPase, pnp, b3164, JW5851

 

FUNCTION:
 
Involved in mRNA degradation. Hydrolyzes single-stranded polyribonucleotides processively in the 3'- to 5'-direction. 
 
CATALYTIC ACTIVITY:
 
RNA(n+1) + phosphate = RNA(n) + a nucleoside diphosphate. 
 
SUBUNIT STRUCTURE:
 
Homotrimer. Organized into a structure (processome or RNA degradosome) containing a number of RNA-processing enzymes, including rne (RNase E) to which it binds.
 
CELLULAR LOCALIZATION:
 
Cytoplasm. Note: Has also been isolated in association with the inner membrane.



This protein can be a part of a given complexes: Activities in which Polyribonucleotide nucleotidyltransferase is involved: Pathways in which Polyribonucleotide nucleotidyltransferase is involved:

NCBI GI number(s): 145698316
49175990
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P05055 P05055
BRENDA - -
KEGG eco:b3164 eco:b3164
PFAM: PF00013
PF03726
PF01138
PF03725
PF00575
PF00013
PF03726
PF01138
PF03725
PF00575
InterPro: IPR001247
IPR015847
IPR004087
IPR004088
IPR009019
IPR012340
IPR016027
IPR012162
IPR015848
IPR003029
IPR020568
IPR022967
IPR001247
IPR015847
IPR004087
IPR004088
IPR009019
IPR012340
IPR016027
IPR012162
IPR015848
IPR003029
IPR020568
IPR022967
CATH: - -
SCOP: - -
Solved crystal structures: 3CDI
3CDJ
3H1C
1SRO
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKKA
KPGQDFFPLTVNYQERTYAAGRIPGSFFRREGRPSEGETLIARLIDRPIR
PLFPEGFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIG
AARVGYINDQYVLNPTQDELKESKLDLVVAGTEAAVLMVESEAQLLSEDQ
MLGAVVFGHEQQQVVIQNINELVKEAGKPRWDWQPEPVNEALNARVAALA
EARLSDAYRITDKQERYAQVDVIKSETIATLLAEDETLDENELGEILHAI
EKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQA
LVTATLGTARDAQVLDELMGERTDTFLFHYNFPPYSVGETGMVGSPKRRE
IGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLAL
MDAGVPIKAAVAGIAMGLVKEGDNYVVLSDILGDEDHLGDMDFKVAGSRD
GISALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQAINAPRGDISE
FAPRIHTIKINPDKIKDVIGKGGSVIRALTEETGTTIEIEDDGTVKIAAT
DGEKAKHAIRRIEEITAEIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVH
ISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIKEATEQSQPAA
APEAPAAEQGE

Polyribonucleotide nucleotidyltransferase (Escherichia coli) is product of expression of pnp gene.

Polyribonucleotide nucleotidyltransferase (Escherichia coli) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Action of RNase II and polynucleotide phosphorylase against RNAs containing stem-loops of defined structure. Spickler C, Mackie GA J Bacteriol 2000-05-01 (182) 10762241
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science 1997-09-05 (277) 9278503
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol 2006-01-01 (2) 16738553
Physical and functional interactions among RNase E, polynucleotide phosphorylase and the cold-shock protein, CsdA: evidence for a 'cold shock degradosome'. Prud'homme-Genereux A, Beran RK, Iost I, Ramey CS, Mackie GA, Simons RW Mol Microbiol 2004-12-01 (54) 15554978
Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12. Link AJ, Robison K, Church GM Electrophoresis 1997-08-01 (18) 9298646
Nucleotide sequence of the pnp gene of Escherichia coli encoding polynucleotide phosphorylase. Homology of the primary structure of the protein with the RNA-binding domain of ribosomal protein S1. Regnier P, Grunberg-Manago M, Portier C J Biol Chem 1987-02-05 (262) 2432069
Expression of the rpsO and pnp genes: structural analysis of a DNA fragment carrying their control regions. Portier C, Regnier P Nucleic Acids Res 1984-08-10 (12) 6382163
Promoter activity and transcript mapping in the regulatory region for genes encoding ribosomal protein S15 and polynucleotide phosphorylase of Escherichia coli. Evans S, Dennis PP Gene 1985-01-01 (40) 3005122
Protein complexes of the Escherichia coli cell envelope. Stenberg F, Chovanec P, Maslen SL, Robinson CV, Ilag LL, von Heijne G, Daley DO J Biol Chem 2005-10-14 (280) 16079137
The solution structure of the S1 RNA binding domain: a member of an ancient nucleic acid-binding fold. Bycroft M, Hubbard TJ, Proctor M, Freund SM, Murzin AG Cell 1997-02-24 (88) 9008164



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-07-05 13:02:58
Edited by a user: kaja
Edited content: Changed structures and publications.

Welcome stranger! Click here to login or here to register.