Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

ATP-dependent RNA helicase rhlB

 
Known abbreviations: rhlB, mmrA, b3780, JW3753

 

FUNCTION:
 
Can carry out ATP-dependent unwinding of double stranded RNA. Has a role in RNA decay. Involved in the RNA degradosome, a multi-enzyme complex important in RNA processing and messenger RNA degradation.
 
CATALYTIC ACTIVITY:
 
ATP + H2O = ADP + phosphate. 
 
SUBUNIT STRUCTURE:
 
Component of the degradosome complex. Binds to RNase E and PNPase. Forms multimers.



This protein can be a part of a given complexes: Activities in which ATP-dependent RNA helicase rhlB is involved: Pathways in which ATP-dependent RNA helicase rhlB is involved:

NCBI GI number(s): 16131636
49175990
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A8J8 P0A8J8
BRENDA - -
KEGG eco:b3780 eco:b3780
PFAM: PF00270
PF00271
PF00270
PF00271
InterPro: IPR011545
IPR014001
IPR001650
IPR000629
IPR023554
IPR014014
IPR011545
IPR014001
IPR001650
IPR000629
IPR023554
IPR014014
CATH: - -
SCOP: - -


Protein sequence:
MSKTHLTEQKFSDFALHPKVVEALEKKGFHNCTPIQALALPLTLAGRDVA
GQAQTGTGKTMAFLTSTFHYLLSHPAIADRKVNQPRALIMAPTRELAVQI
HADAEPLAEATGLKLGLAYGGDGYDKQLKVLESGVDILIGTTGRLIDYAK
QNHINLGAIQVVVLDEADRMYDLGFIKDIRWLFRRMPPANQRLNMLFSAT
LSYRVRELAFEQMNNAEYIEVEPEQKTGHRIKEELFYPSNEEKMRLLQTL
IEEEWPDRAIIFANTKHRCEEIWGHLAADGHRVGLLTGDVAQKKRLRILD
EFTRGDLDILVATDVAARGLHIPAVTHVFNYDLPDDCEDYVHRIGRTGRA
GASGHSISLACEEYALNLPAIETYIGHSIPVSKYNPDALMTDLPKPLRLT
RPRTGNGPRRTGAPRNRRRSG

ATP-dependent RNA helicase rhlB (Escherichia coli) is product of expression of rhlB gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science 1997-09-05 (277) 9278503
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol 2006-01-01 (2) 16738553
A DEAD-box RNA helicase in the Escherichia coli RNA degradosome. Py B, Higgins CF, Krisch HM, Carpousis AJ Nature 1996-05-09 (381) 8610017
rhlB, a new Escherichia coli K-12 gene with an RNA helicase-like protein sequence motif, one of at least five such possible genes in a prokaryote. Kalman M, Murphy H, Cashel M New Biol 1991-09-01 (3) 1931833
Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes. Daniels DL, Plunkett G 3rd, Burland V, Blattner FR Science 1992-08-07 (257) 1379743
DEAD box RhlB RNA helicase physically associates with exoribonuclease PNPase to degrade double-stranded RNA independent of the degradosome-assembling region of RNase E. Liou GG, Chang HY, Lin CS, Lin-Chao S J Biol Chem 2002-10-25 (277) 12181321



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.