Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RNA pyrophosphohydrolase

 
Known also as: (Di)nucleoside polyphosphate hydrolase, Ap5A pyrophosphatase

Known abbreviations: rppH,nudH, ygdP,b2830, JW2798

 

FUNCTION:
 
Master regulator of 5'-dependent mRNA decay. Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage. Preferentially hydrolyzes diadenosine penta-phosphate with ATP as one of the reaction products. Also able to hydrolyze diadenosine hexa- and tetra-phosphate. Has no activity on diadenosine tri-phosphate, ADP-ribose, NADH and UDP-glucose. In the meningitis causing strain E.coli K1, has been shown to play a role in HBMEC (human brain microvascular endothelial cells) invasion in vitro. 
 
COFACTOR:
 
Magnesium or zinc. Manganese can be used to a lesser extent. 
 
SUBUNIT STRUCTURE:
 
Monomer.



Activities in which RNA pyrophosphohydrolase is involved: Pathways in which RNA pyrophosphohydrolase is involved:

NCBI GI number(s): 16130734
49175990
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A776 P0A776
BRENDA - -
KEGG eco:b2830 eco:b2830
PFAM: PF00293
PF00293
InterPro: IPR020476
IPR020084
IPR000086
IPR015797
IPR022927
IPR020476
IPR020084
IPR000086
IPR015797
IPR022927
CATH: - -
SCOP: - -
Solved crystal structures: 2KDW
2KDV
[PDB] [details]
[PDB] [details]


Protein sequence:
MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAM
YRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWF
LLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKE
FASVVMSLQENTPKPQNASAYRRKRG

RNA pyrophosphohydrolase (Escherichia coli) is product of expression of rppH gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science 1997-09-05 (277) 9278503
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol 2006-01-01 (2) 16738553
The gene ygdP, associated with the invasiveness of Escherichia coli K1, designates a Nudix hydrolase, Orf176, active on adenosine (5')-pentaphospho-(5')-adenosine (Ap5A). Bessman MJ, Walsh JD, Dunn CA, Swaminathan J, Weldon JE, Shen J J Biol Chem 2001-10-12 (276) 11479323
Identification of Escherichia coli K1 genes contributing to human brain microvascular endothelial cell invasion by differential fluorescence induction. Badger JL, Wass CA, Kim KS Mol Microbiol 2000-04-01 (36) 10760174
The bacterial enzyme RppH triggers messenger RNA degradation by 5' pyrophosphate removal. Deana A, Celesnik H, Belasco JG Nature 2008-02-17 (451) 18202662



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.