Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Oligoribonuclease

 
Known abbreviations: orn, yjeR,b4162, JW5740

 

FUNCTION:
 
3'-to-5' exoribonuclease specific for small oligoribonucleotides. 
 
SUBUNIT STRUCTURE:
 
Homodimer.
 
CELLULAR LOCALIZATION:
 
Cytoplasm



Activities in which Oligoribonuclease is involved: Pathways in which Oligoribonuclease is involved:

NCBI GI number(s): 90111697
49175990
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A784 P0A784
BRENDA - -
KEGG eco:b4162 eco:b4162
PFAM: PF00929
PF00929
InterPro: IPR006055
IPR013520
IPR022894
IPR012337
IPR006055
IPR013520
IPR022894
IPR012337
CATH: - -
SCOP: - -
Solved crystal structures: 1YTA
2IGI
[PDB] [details]
[PDB] [details]


Protein sequence:
MSANENNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPTIAVHQ
SDEQLALMDDWNVRTHTASGLVERVKASTMGDREAELATLEFLKQWVPAG
KSPICGNSIGQDRRFLFKYMPELEAYFHYRYLDVSTLKELARRWKPEILD
GFTKQGTHQAMDDIRESVAELAYYREHFIKL

Oligoribonuclease (Escherichia coli) is product of expression of orn gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Oligoribonuclease is a common downstream target of lithium-induced pAp accumulation in Escherichia coli and human cells. Mechold U, Ogryzko V, Ngo S, Danchin A Nucleic Acids Res 2006-01-01 (34) 16682444
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science 1997-09-05 (277) 9278503
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol 2006-01-01 (2) 16738553
Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes. Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL, Blattner FR Nucleic Acids Res 1995-06-25 (23) 7610040
Oligoribonuclease is encoded by a highly conserved gene in the 3'-5' exonuclease superfamily. Zhang X, Zhu L, Deutscher MP J Bacteriol 1998-05-01 (180) 9573169



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-07-05 15:02:21
Edited by a user: kaja
Edited content: Changed structures and publications.

Welcome stranger! Click here to login or here to register.