Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Poly(A) polymerase

 
Known also as: Plasmid copy number protein

Known abbreviations: pcnB, b0143, JW5808

 

FUNCTION:
 
Polymerase that creates the 3' poly(A) tail found in some mRNAs. Seems to be involved in plasmid copy number control. 
 
CATALYTIC ACTIVITY:
 
ATP + RNA(n) = diphosphate + RNA(n+1).
 
CATALYTIC ACTIVITY:
 
Monomer. Interacts with CsdA, RhlE and SrmB.



Activities in which Poly(A) polymerase is involved: Pathways in which Poly(A) polymerase is involved:

NCBI GI number(s): 162135892
49175990
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0ABF1 P0ABF1
BRENDA - -
KEGG eco:b0143 eco:b0143
PFAM: PF01743
PF01743
InterPro: IPR002646
IPR010206
IPR002646
IPR010206
CATH: - -
SCOP: - -


Protein sequence:
MFTRVANFCRKVLSREESEAEQAVARPQVTVIPREQHAISRKDISENALK
VMYRLNKAGYEAWLVGGGVRDLLLGKKPKDFDVTTNATPEQVRKLFRNCR
LVGRRFRLAHVMFGPEIIEVATFRGHHEGNVSDRTTSQRGQNGMLLRDNI
FGSIEEDAQRRDFTINSLYYSVADFTVRDYVGGMKDLKDGVIRLIGNPET
RYREDPVRMLRAVRFAAKLGMRISPETAEPIPRLATLLNDIPPARLFEES
LKLLQAGYGYETYKLLCEYHLFQPLFPTITRYFTENGDSPMERIIEQVLK
NTDTRIHNDMRVNPAFLFAAMFWYPLLETAQKIAQESGLTYHDAFALAMN
DVLDEACRSLAIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLLEHPKFRAA
YDLLALRAEVERNAELQRLVKWWGEFQVSAPPDQKGMLNELDEEPSPRRR
TRRPRKRAPRREGTA

Poly(A) polymerase (Escherichia coli) is product of expression of pcnB gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science 1997-09-05 (277) 9278503
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol 2006-01-01 (2) 16738553
Genetics and sequence analysis of the pcnB locus, an Escherichia coli gene involved in plasmid copy number control. Liu JD, Parkinson JS J Bacteriol 1989-03-01 (171) 2537812
Systematic sequencing of the Escherichia coli genome: analysis of the 2.4-4.1 min (110,917-193,643 bp) region. Fujita N, Mori H, Yura T, Ishihama A Nucleic Acids Res 1994-05-11 (22) 8202364
Identification of the gene for an Escherichia coli poly(A) polymerase. Cao GJ, Sarkar N Proc Natl Acad Sci U S A 1992-11-01 (89) 1438224
A possible role for the pcnB gene product of Escherichia coli in modulating RNA: RNA interactions. Masters M, March JB, Oliver IR, Collins JF Mol Gen Genet 1990-02-01 (220) 1691435
Poly(A) polymerase I of Escherichia coli: characterization of the catalytic domain, an RNA binding site and regions for the interaction with proteins involved in mRNA degradation. Raynal LC, Carpousis AJ Mol Microbiol 1999-05-01 (32) 10361280
Expression of the Escherichia coli pcnB gene is translationally limited using an inefficient start codon: a second chromosomal example of translation initiated at AUU. Binns N, Masters M Mol Microbiol 2002-06-01 (44) 12068810



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.