Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

rRNA 2'-O-methyltransferase fibrillarin

 
Known also as: 34 kDa nucleolar scleroderma antigen

Known abbreviations: FBL, FIB1, FLRN

 

FUNCTION:
 
Involved in pre-rRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA.
 
SUBUNIT STRUCTURE:
 
Interacts with NOLC1 By similarity. Component of box C/D small nucleolar ribonucleoprotein (snoRNP) particles that contain NHP2L1, FBL, NOP5 and NOP56, plus a guide RNA. It is associated with the U3, U8, U13, X and Y small nuclear RNAs. Component of several ribosomal and nucleolar protein complexes. Interacts with PRMT5 and UTP20. Interacts with DDX5. 
 
CELLULAR LOCALIZATION:
 
Nucleus › nucleolus. Note: Fibrillar region of the nucleolus. 
 
POST-TRANSLATIONAL MODIFICATION:
 
By homology to other fibrillarins, some or all of the N-terminal domain arginines are modified to asymmetric dimethylarginine (DMA).
 



This protein can be a part of a given complexes: Activities in which rRNA 2'-O-methyltransferase fibrillarin is involved: Pathways in which rRNA 2'-O-methyltransferase fibrillarin is involved:

NCBI GI number(s): 12056465
215272338
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot P22087 P22087
BRENDA - -
KEGG hsa:2091 hsa:2091
PFAM: PF01269
PF01269
InterPro: IPR000692
IPR020813
IPR000692
IPR020813
CATH: - -
SCOP: - -
Solved crystal structures: 2IPX
[PDB] [details]


Protein sequence:
MKPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGG
GGGGGGGGRGGGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICR
GKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILG
GVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDL
INLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNA
HTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLE
PYERDHAVVVGVYRPPPKVKN

RRNA 2'-O-methyltransferase fibrillarin (Homo sapiens) is product of expression of FBL gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
The DNA sequence and biology of human chromosome 19. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M Nature 2004-04-01 (428) 15057824
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Lysine acetylation targets protein complexes and co-regulates major cellular functions. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M Science 2009-08-14 (325) 19608861
Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Wang B, Malik R, Nigg EA, Korner R Anal Chem 2008-12-15 (80) 19007248
The nuclear DEAD box RNA helicase p68 interacts with the nucleolar protein fibrillarin and colocalizes specifically in nascent nucleoli during telophase. Nicol SM, Causevic M, Prescott AR, Fuller-Pace FV Exp Cell Res 2000-06-15 (257) 10837141
cDNA cloning and sequencing of human fibrillarin, a conserved nucleolar protein recognized by autoimmune antisera. Aris JP, Blobel G Proc Natl Acad Sci U S A 1991-01-01 (88) 1846968
Evolutionary conservation of the human nucleolar protein fibrillarin and its functional expression in yeast. Jansen RP, Hurt EC, Kern H, Lehtonen H, Carmo-Fonseca M, Lapeyre B, Tollervey D J Cell Biol 1991-05-01 (113) 2026646
Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N Nat Methods 2008-12-01 (5) 19054851
Purification and partial characterization of a nucleolar scleroderma antigen (Mr = 34,000; pI, 8.5) rich in NG,NG-dimethylarginine. Lischwe MA, Ochs RL, Reddy R, Cook RG, Yeoman LC, Tan EM, Reichlin M, Busch H J Biol Chem 1985-11-15 (260) 2414294
An intact Box C sequence in the U3 snRNA is required for binding of fibrillarin, the protein common to the major family of nucleolar snRNPs. Baserga SJ, Yang XD, Steitz JA EMBO J 1991-09-01 (10) 1714385
Human fibrillarin forms a sub-complex with splicing factor 2-associated p32, protein arginine methyltransferases, and tubulins alpha 3 and beta 1 that is independent of its association with preribosomal ribonucleoprotein complexes. Yanagida M, Hayano T, Yamauchi Y, Shinkawa T, Natsume T, Isobe T, Takahashi N J Biol Chem 2004-02-16 (279) 14583623
Human 1A6/DRIM, the homolog of yeast Utp20, functions in the 18S rRNA processing. Wang Y, Liu J, Zhao H, Lu W, Zhao J, Yang L, Li N, Du X, Ke Y Biochim Biophys Acta 2007-06-01 (1773) 17498821



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.