|
Known also as: Nucleolar protein 5
Known abbreviations: NOP58, NOL5, NOP5, HSPC120
FUNCTION:
Required for 60S ribosomal subunit biogenesis (By similarity.)
SUBUNIT STRUCTURE:
Interacts with NOLC1/Nopp140 By similarity. Component of box C/D small nucleolar ribonucleoprotein (snoRNP) particles.
CELLULAR LOCALIZATION:
Nucleus › nucleolus.
TISSUE SPECIFICITY:
Ubiquitous.
POST-TRANSLATIONAL MODIFICATION:
Sumoylation is essential for high-affinity binding to snoRNAs.
|
This protein can be a part of a given complexes:
Activities in which Nucleolar protein 58 is involved:
Pathways in which Nucleolar protein 58 is involved:
Links to other databases:
Protein sequence:
MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKF
QDTAEALAAFTALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKE
KLNLSCIHSPVVNELMRGIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYR
LKFSADKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKIISD
NLTYCKCLQKVGDRKNYASAKLSELLPEEVEAEVKAAAEISMGTEVSEED
ICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIA
HAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQT
SPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLED
RGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDK
EDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEP
LSEEEPCTSTAIASPEKKKKKKKKRENED
|
Nucleolar protein 58 (Homo sapiens) is product of expression of
NOP58
gene.
References:
Title |
Authors |
Journal
| Publication date (Issue)
| PubMed ID
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K |
Genome Res
|
2004-10-01 (14) |
15489334 |
Generation and annotation of the DNA sequences of human chromosomes 2 and 4. |
Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M |
Nature
|
2005-04-07 (434) |
15815621 |
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. |
Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M |
Cell
|
2006-11-03 (127) |
17081983 |
Initial characterization of the human central proteome. |
Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J |
BMC Syst Biol
|
2011-01-01 (5) |
21269460 |
The full-ORF clone resource of the German cDNA Consortium. |
Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I |
BMC Genomics
|
2007-01-01 (8) |
17974005 |
A quantitative atlas of mitotic phosphorylation. |
Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP |
Proc Natl Acad Sci U S A
|
2008-08-05 (105) |
18669648 |
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. |
Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK |
Sci Signal
|
2009-01-01 (2) |
19690332 |
Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. |
Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M |
Mol Cell
|
2008-08-08 (31) |
18691976 |
Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. |
Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd |
J Proteome Res
|
2008-03-01 (7) |
18220336 |
Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. |
Wang B, Malik R, Nigg EA, Korner R |
Anal Chem
|
2008-12-15 (80) |
19007248 |
Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment. |
Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J |
J Proteome Res
|
2008-12-01 (7) |
19367720 |
Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells. |
Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G, Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ, Chen Z |
Genome Res
|
2000-10-01 (10) |
11042152 |
Phosphoproteome analysis of the human mitotic spindle. |
Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R |
Proc Natl Acad Sci U S A
|
2006-04-04 (103) |
16565220 |
Functional proteomic analysis of human nucleolus. |
Scherl A, Coute Y, Deon C, Calle A, Kindbeiter K, Sanchez JC, Greco A, Hochstrasser D, Diaz JJ |
Mol Biol Cell
|
2002-11-01 (13) |
12429849 |
Isolation and characterization of a novel PDGF-induced human gene. |
Nelson SA, Santora KE, LaRochelle WJ |
Gene
|
2000-07-25 (253) |
10925205 |
Human Nop5/Nop58 is a component common to the box C/D small nucleolar ribonucleoproteins. |
Lyman SK, Gerace L, Baserga SJ |
RNA
|
1999-12-01 (5) |
10606270 |
A proteomic screen for nucleolar SUMO targets shows SUMOylation modulates the function of Nop5/Nop58. |
Westman BJ, Verheggen C, Hutten S, Lam YW, Bertrand E, Lamond AI |
Mol Cell
|
2010-08-27 (39) |
20797632 |
Add your own comment!
There are no comments yet.
Last modification of this entry: Sept. 25, 2012.
|