Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

tRNA ligase

 
Known abbreviations: TRL1, RLG1, YJL087C, J0927

 

FUNCTION:
 
One of the two proteins required for the splicing of precursor tRNA molecules containing introns. The ligation activity require three enzymatic activities: phosphorylation of the 5' terminus of the 3' half-tRNA in the presence of ATP, opening of the 2'3'-cyclic phosphodiester bond of the 5' half-tRNA leaving a 2'-phosphomonoester and ligation of the two tRNA halves in an ATP-dependent reaction.
 
CATALYTIC ACTIVITY:
 
ATP + (ribonucleotide)(n) + (ribonucleotide)(m) = AMP + diphosphate + (ribonucleotide)(n+m).
 
DOMAIN:
 
Has three domain each corresponding to an enzymatic activity, namely in N- to C-terminal order: ligase, kinase and cyclic phosphodiesterase (CPDase).



Activities in which tRNA ligase is involved: Pathways in which tRNA ligase is involved:

NCBI GI number(s): 6322374
296145933
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P09880 P09880
BRENDA - -
KEGG sce:YJL087C sce:YJL087C
PFAM: PF09511
PF08302
PF08303
PF09511
PF08302
PF08303
InterPro: IPR019039
IPR012387
IPR015966
IPR015965
IPR019039
IPR012387
IPR015966
IPR015965
CATH: - -
SCOP: - -


Protein sequence:
MPSPYDGKRTVTQLVNELEKAEKLSGRGRAYRRVCDLSHSNKKVISWKFN
EWDYGKNTITLPCNARGLFISDDTTNPVIVARGYDKFFNVGEVNFTKWNW
IEENCTGPYDVTIKANGCIIFISGLEDGTLVVCSKHSTGPRADVDRNHAE
AGEKQLLRQLAAMNINRSDFARMLYTHNVTAVAEYCDDSFEEHILEYPLE
KAGLYLHGVNVNKAEFETWDMKDVSQMASKYGFRCVQCITSNTLEDLKKF
LDNCSATGSFEGQEIEGFVIRCHLKSTEKPFFFKYKFEEPYLMYRQWREV
TKDYISNKSRVFKFRKHKFITNKYLDFAIPILESSPKICENYLKGFGVIE
LRNKFLQSYGMSGLEILNHEKVAELELKNAIDYDKVDERTKFLIFPISVI
GCGKTTTSQTLVNLFPDSWGHIQNDDITGKDKSQLMKKSLELLSKKEIKC
VIVDRNNHQFRERKQLFEWLNELKEDYLVYDTNIKVIGVSFAPYDKLSEI
RDITLQRVIKRGNNHQSIKWDELGEKKVVGIMNGFLKRYQPVNLDKSPDN
MFDLMIELDFGQADSSLTNAKQILNEIHKAYPILVPEIPKDDEIETAFRR
SLDYKPTVRKIVGKGNNNQQKTPKLIKPTYISAKIENYDEIIELVKRCIA
SDAELTEKFKHLLASGKVQKELHITLGHVMSSREKEAKKLWKSYCNRYTD
QITEYNNNRIENAQGSGNNQNTQVKTTDKLNFRLEKLCWDEKIIAIVVEL
SKDKDGCIIDENNEKIKGLCCQNKIPHITLCKLESGVKAVYSNVLCEKVE
SAEVDENIKVVKLDNSKEFVGSVYLNF

TRNA ligase (Saccharomyces cerevisiae) is product of expression of TRL1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X. Galibert F, Alexandraki D, Baur A, Boles E, Chalwatzis N, Chuat JC, Coster F, Cziepluch C, De Haan M, Domdey H, Durand P, Entian KD, Gatius M, Goffeau A, Grivell LA, Hennemann A, Herbert CJ, Heumann K, Hilger F, Hollenberg CP, Huang ME, Jacq C, Jauniaux JC, Katsoulou C, Karpfinger-Hartl L, et al. EMBO J 1996-05-01 (15) 8641269
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Structure and function of the yeast tRNA ligase gene. Westaway SK, Phizicky EM, Abelson J J Biol Chem 1988-03-05 (263) 3277966
Sequence analysis of a 33.1 kb fragment from the left arm of Saccharomyces cerevisiae chromosome X, including putative proteins with leucine zippers, a fungal Zn(II)2-Cys6 binuclear cluster domain and a putative alpha 2-SCB-alpha 2 binding site. Miosga T, Schaaff-Gerstenschlager I, Chalwatzis N, Baur A, Boles E, Fournier C, Schmitt S, Velten C, Wilhelm N, Zimmermann FK Yeast 1995-06-15 (11) 7483841
Domain structure in yeast tRNA ligase. Xu Q, Teplow D, Lee TD, Abelson J Biochemistry 1990-07-03 (29) 2207062



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.