Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

tRNA 2'-phosphotransferase

 
Known abbreviations: TPT1, YOL102C, HRE230

 

FUNCTION:
 
Catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1''-2'' cyclic phosphate.
 
CATALYTIC ACTIVITY:
 
2'-phospho-[ligated tRNA] + NAD+ = mature tRNA + ADP ribose 1'',2''-phosphate + nicotinamide + H2O.



Activities in which tRNA 2'-phosphotransferase is involved: Pathways in which tRNA 2'-phosphotransferase is involved:

NCBI GI number(s): 6324470
296147904
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q12272 Q12272
BRENDA - -
KEGG sce:YOL102C sce:YOL102C
PFAM: PF01885
PF01885
InterPro: IPR002745
IPR002745
CATH: - -
SCOP: - -


Protein sequence:
MRQVLQKDKRDVQLSKALSYLLRHTAVKEKLTIDSNGYTPLKELLSHNRL
KTHKCTVDDIHRIVKENDKQRFHIKTLGADEEWICATQGHSIKSIQPSDE
VLVPITEASQLPQELIHGTNLQSVIKIIESGAISPMSRNHVHLSPGMLHA
KGVISGMRSSSNVYIFIDCHSPLFFQTLKMFRSLNNVYLSSSIPVELIQK
VVVKGNLKDEEKLDTLRRILHERNIPLEKI

TRNA 2'-phosphotransferase (Saccharomyces cerevisiae) is product of expression of TPT1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. Nature 1997-05-01 (387) 9169874
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Sequence analysis of a 44 kb DNA fragment of yeast chromosome XV including the Tyl-H3 retrotransposon, the suf1(+) frameshift suppressor gene for tRNA-Gly, the yeast transfer RNA-Thr-1a and a delta element. Vandenbol M, Durand P, Portetelle D, Hilger F Yeast 1995-09-15 (11) 7502582
A 2'-phosphotransferase implicated in tRNA splicing is essential in Saccharomyces cerevisiae. Culver GM, McCraith SM, Consaul SA, Stanford DR, Phizicky EM J Biol Chem 1997-05-16 (272) 9148937
Transient ADP-ribosylation of a 2'-phosphate implicated in its removal from ligated tRNA during splicing in yeast. Spinelli SL, Kierzek R, Turner DH, Phizicky EM J Biol Chem 1999-02-01 (274) 9915792



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.