Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1

 
Known also as: Cap1 2'O-ribose methyltransferase 1, FtsJ methyltransferase domain-containing protein 2, Interferon-stimulated gene 95 kDa protein

Known abbreviations: MTr1, hMTr1, ISG95, FTSJD2, KIAA0082, MTR1

 

FUNCTION:
 
S-adenosyl-L-methionine-dependent methyltransferase that mediates mRNA cap1 2'-O-ribose methylation to the 5'-cap structure of mRNAs. Methylates the ribose of the first nucleotide of a m7GpppG-capped mRNA to produce m7GpppNmp (cap1). Cap1 modification is linked to higher levels of translation. May be involved in the interferon response pathway. 
 
CATALYTIC ACTIVITY:
 
S-adenosyl-L-methionine + m7G(5')pppR-RNA = S-adenosyl-L-homocysteine + m7G(5')pppRm-RNA.
 
SUBUNIT STRUCTURE:
 
Interacts with POLR2A (via C-terminus). 
 
CELLULAR LOCALIZATION:
 
Nucleus.
 
INDUCTION:
 
By interferons alpha and beta, and by Vaccinia virus infection. 



Activities in which Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 is involved: Pathways in which Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 is involved:

NCBI GI number(s): 24307983
194688144
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q8N1G2 Q8N1G2
BRENDA - -
KEGG hsa:23070 hsa:23070
PFAM: PF01728
PF01585
PF01728
PF01585
InterPro: IPR025816
IPR000467
IPR002877
IPR001202
IPR025816
IPR000467
IPR002877
IPR001202
CATH: - -
SCOP: - -


Protein sequence:
MKRRTDPECTAPIKKQKKRVAELALSLSSTSDDEPPSSVSHGAKASTTSL
SGSDSETEGKQHSSDSFDDAFKADSLVEGTSSRYSMYNSVSQKLMAKMGF
REGEGLGKYSQGRKDIVEASSQKGRRGLGLTLRGFDQELNVDWRDEPEPS
ACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVL
QCKSVFDVLDGEEMRRARTRANPYEMIRGVFFLNRAAMKMANMDFVFDRM
FTNPRDSYGKPLVKDREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGM
TLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVL
DNTDRKGVHFLMADGGFSVEGQENLQEILSKQLLLCQFLMALSIVRTGGH
FICKTFDLFTPFSVGLVYLLYCCFERVCLFKPITSRPANSERYVVCKGLK
VGIDDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSN
ESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPS
SSDPKSKFFELIQGTEIDIFSYKPTLLTSKTLEKIRPVFDYRCMVSGSEQ
KFLIGLGKSQIYTWDGRQSDRWIKLDLKTELPRDTLLSVEIVHELKGEGK
AQRKISAIHILDVLVLNGTDVREQHFNQRIQLAEKFVKAVSKPSRPDMNP
IRVKEVYRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYI
VRTVNEPWTMGFSKSFKKKFFYNKKTKDSTFDLPADSIAPFHICYYGRLF
WEWGDGIRVHDSQKPQDQDKLSKEDVLSFIQMHRA

Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 (Homo sapiens) is product of expression of FTSJD2 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M Cell 2006-11-03 (127) 17081983
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Lysine acetylation targets protein complexes and co-regulates major cellular functions. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M Science 2009-08-14 (325) 19608861
The DNA sequence and analysis of human chromosome 6. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE Nature 2003-10-23 (425) 14574404
Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1. Nagase T, Miyajima N, Tanaka A, Sazuka T, Seki N, Sato S, Tabata S, Ishikawa K, Kawarabayasi Y, Kotani H, et al. DNA Res 1995-01-01 (2) 7788527
Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ Cell 2007-12-14 (131) 18083107
Gene expression profiling of the cellular transcriptional network regulated by alpha/beta interferon and its partial attenuation by the hepatitis C virus nonstructural 5A protein. Geiss GK, Carter VS, He Y, Kwieciszewski BK, Holzman T, Korth MJ, Lazaro CA, Fausto N, Bumgarner RE, Katze MG J Virol 2003-06-01 (77) 12743294
Cellular gene expression survey of vaccinia virus infection of human HeLa cells. Guerra S, Lopez-Fernandez LA, Pascual-Montano A, Munoz M, Harshman K, Esteban M J Virol 2003-06-01 (77) 12743306
The human interferon-regulated ISG95 protein interacts with RNA polymerase II and shows methyltransferase activity. Haline-Vaz T, Silva TC, Zanchin NI Biochem Biophys Res Commun 2008-08-08 (372) 18533109
Characterization of hMTr1, a human Cap1 2'-O-ribose methyltransferase. Belanger F, Stepinski J, Darzynkiewicz E, Pelletier J J Biol Chem 2010-10-22 (285) 20713356



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.