Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Angiogenin

 
Known also as: Ribonuclease 5

Known abbreviations: ANG, RNASE5

 

FUNCTION:
 
May function as a tRNA-specific ribonuclease that abolishes protein synthesis by specifically hydrolyzing cellular tRNAs. Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo. 
 
SUBUNIT STRUCTURE:
 
Interacts with and forms a tight 1:1 complex with RNH1. Dimerization of two such complexes may occur.
 
CELLULAR LOCALIZATION:
 
Secreted.
 
TISSUE SPECIFICITY:
 
Expressed predominantly in the liver. Also detected in endothelial cells and spinal cord neurons. 
 
DEVELOPMENT STAGE:
 
Low level expression in the developing fetus, increased in the neonate, and maximal in the adult.
 
INVOLVEMENT IN DISEASE:
 
Defects in ANG are the cause of susceptibility to amyotrophic lateral sclerosis type 9 (ALS9) [MIM:611895]. ALS is a degenerative disorder of motor neurons in the cortex, brain stem and spinal cord. ALS is characterized by muscular weakness and atrophy. 



Activities in which Angiogenin is involved: Pathways in which Angiogenin is involved:

NCBI GI number(s): 148277046
207113180
4557313
207113179
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot P03950 P03950
BRENDA - -
KEGG hsa:283 hsa:283
PFAM: PF00074
PF00074
InterPro: IPR001427
IPR023411
IPR023412
IPR001427
IPR023411
IPR023412
CATH: - -
SCOP: - -
Solved crystal structures: 1H53
1H52
1H0D
1GV7
1B1J
1B1I
1B1E
1AWZ
1ANG
1A4Y
2ANG
1UN5
1UN4
1UN3
1K5B
1K5A
1K59
1K58
1HBY
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYC
ESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSF
QVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP

Angiogenin (Homo sapiens) is product of expression of ANG gene.

Angiogenin (Homo sapiens) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Molecular recognition of human angiogenin by placental ribonuclease inhibitor--an X-ray crystallographic study at 2.0 A resolution. Papageorgiou AC, Shapiro R, Acharya KR EMBO J 1997-09-01 (16) 9311977
Three-dimensional solution structure of human angiogenin determined by 1H,15N-NMR spectroscopy--characterization of histidine protonation states and pKa values. Lequin O, Thuring H, Robin M, Lallemand JY Eur J Biochem 1997-12-15 (250) 9461294
Refined crystal structures of native human angiogenin and two active site variants: implications for the unique functional properties of an enzyme involved in neovascularisation during tumour growth. Leonidas DD, Shapiro R, Allen SC, Subbarao GV, Veluraja K, Acharya KR J Mol Biol 1999-02-22 (285) 9918722
The crystal structure of human angiogenin in complex with an antitumor neutralizing antibody. Chavali GB, Papageorgiou AC, Olson KA, Fett JW, Hu G, Shapiro R, Acharya KR Structure 2003-07-01 (11) 12842050
Sequence of the cDNA and gene for angiogenin, a human angiogenesis factor. Kurachi K, Davie EW, Strydom DJ, Riordan JF, Vallee BL Biochemistry 1985-09-24 (24) 2866795
Diversifying selection of the tumor-growth promoter angiogenin in primate evolution. Zhang J, Rosenberg HF Mol Biol Evol 2002-04-01 (19) 11919285
Amino acid sequence of human tumor derived angiogenin. Strydom DJ, Fett JW, Lobb RR, Alderman EM, Bethune JL, Riordan JF, Vallee BL Biochemistry 1985-09-24 (24) 2866794
Tissue distribution and developmental expression of the messenger RNA encoding angiogenin. Weiner HL, Weiner LH, Swain JL Science 1987-07-17 (237) 2440105
Angiogenin is a cytotoxic, tRNA-specific ribonuclease in the RNase A superfamily. Saxena SK, Rybak SM, Davey RT Jr, Youle RJ, Ackerman EJ J Biol Chem 1992-10-25 (267) 1400510
Site-specific mutagenesis reveals differences in the structural bases for tight binding of RNase inhibitor to angiogenin and RNase A. Chen CZ, Shapiro R Proc Natl Acad Sci U S A 1997-03-04 (94) 9050852
Superadditive and subadditive effects of "hot spot" mutations within the interfaces of placental ribonuclease inhibitor with angiogenin and ribonuclease A. Chen CZ, Shapiro R Biochemistry 1999-07-20 (38) 10413501
Ribonuclease inhibitor regulates neovascularization by human angiogenin. Dickson KA, Kang DK, Kwon YS, Kim JC, Leland PA, Kim BM, Chang SI, Raines RT Biochemistry 2009-05-12 (48) 19354288
Crystal structure of human angiogenin reveals the structural basis for its functional divergence from ribonuclease. Acharya KR, Shapiro R, Allen SC, Riordan JF, Vallee BL Proc Natl Acad Sci U S A 1994-04-12 (91) 8159679
Binding of phosphate and pyrophosphate ions at the active site of human angiogenin as revealed by X-ray crystallography. Leonidas DD, Chavali GB, Jardine AM, Li S, Shapiro R, Acharya KR Protein Sci 2001-08-01 (10) 11468363
Crystallographic studies on the role of the C-terminal segment of human angiogenin in defining enzymatic potency. Leonidas DD, Shapiro R, Subbarao GV, Russo A, Acharya KR Biochemistry 2002-01-26 (41) 11851402
Crystallographic studies on structural features that determine the enzymatic specificity and potency of human angiogenin: Thr44, Thr80, and residues 38-41. Holloway DE, Chavali GB, Hares MC, Baker MD, Subbarao GV, Shapiro R, Acharya KR Biochemistry 2004-01-10 (43) 14756559
Mechanisms of loss of functions of human angiogenin variants implicated in amyotrophic lateral sclerosis. Padhi AK, Kumar H, Vasaikar SV, Jayaram B, Gomes J PLoS One 2012-01-01 (7) 22384259
A novel candidate region for ALS on chromosome 14q11.2. Greenway MJ, Alexander MD, Ennis S, Traynor BJ, Corr B, Frost E, Green A, Hardiman O Neurology 2004-11-23 (63) 15557516
ANG mutations segregate with familial and 'sporadic' amyotrophic lateral sclerosis. Greenway MJ, Andersen PM, Russ C, Ennis S, Cashman S, Donaghy C, Patterson V, Swingler R, Kieran D, Prehn J, Morrison KE, Green A, Acharya KR, Brown RH Jr, Hardiman O Nat Genet 2006-04-01 (38) 16501576
Angiogenin loss-of-function mutations in amyotrophic lateral sclerosis. Wu D, Yu W, Kishikawa H, Folkerth RD, Iafrate AJ, Shen Y, Xin W, Sims K, Hu GF Ann Neurol 2007-12-01 (62) 17886298
Characterization of human angiogenin variants implicated in amyotrophic lateral sclerosis. Crabtree B, Thiyagarajan N, Prior SH, Wilson P, Iyer S, Ferns T, Shapiro R, Brew K, Subramanian V, Acharya KR Biochemistry 2007-10-23 (46) 17900154
Identification of new ANG gene mutations in a large cohort of Italian patients with amyotrophic lateral sclerosis. Gellera C, Colombrita C, Ticozzi N, Castellotti B, Bragato C, Ratti A, Taroni F, Silani V Neurogenetics 2008-01-01 (9) 18087731
A novel Angiogenin gene mutation in a sporadic patient with amyotrophic lateral sclerosis from southern Italy. Conforti FL, Sprovieri T, Mazzei R, Ungaro C, La Bella V, Tessitore A, Patitucci A, Magariello A, Gabriele AL, Tedeschi G, Simone IL, Majorana G, Valentino P, Condino F, Bono F, Monsurro MR, Muglia M, Quattrone A Neuromuscul Disord 2008-02-01 (18) 17703939



Add your own comment!


There are no comments yet.

Last modification of this entry: 2013-02-01 13:57:02
Edited by a user: kaja
Edited content: Changed protein_family.

Welcome stranger! Click here to login or here to register.