Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Transcriptional protein SWT1

 
Known abbreviations: SWT1, C1orf26


NCBI GI number(s): 157502209
157502208
157502206
157502207
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q5T5J6 Q5T5J6
BRENDA - -
KEGG hsa:54823 hsa:54823
PFAM: - Q5T5J6 (Link - using uniprot id)
InterPro: IPR006596
IPR006596
CATH: - -
SCOP: - -


Protein sequence:
MSSKESCGKKETSQRKDTTTSSPNFGEKDKKERKTPASSTSSSSIRSVSS
EKRKLKSDHTDVLYYNIKRRQGLKRLSVEIDTLRRRPKIGSSSQRPIKLK
EASYSNDNQIILQSPSSNGTKKDIHKCVDFKPKDIKLTNAGSKLDHGIKS
LSSPKIASDVKPKAEGQASENKWSHLLVQREKMKELKKGRNSKFRDNSEK
CVLEKWKRNQFSQDYNSNKIIKEPLGSRRQKISFKIPIKSRDTLQKLVEE
NVFNIDSNNSKTKQEEREYLESSQVSLNVTRQKTEHLLSDFTYKRTVHEW
KRKHHYDHQESNDSHSRENLTQSFEAPCCSVSSESIQDADQEMQIVEELH
AARVGKSVDLPGELMSMEIDLEDDVHSSSANNTSDRKLLIVIDTNILMNH
LKFVRILKTTEVPGFDKLVLIIPWVVMQELDRMKEGKLLKRAQHKAIPAV
HFINDSLKNQDRKLWGQSIQLASQKHYGLSDENNDDRVLKCCLQHQELFP
CSFVILCTDDRNLRNKGLISGVKSLSKEELSAELLHLSLNTDVCHQPCIP
KQQLKAETTPLKESYKEESTNSGLSILLESIVSDLEKSLGTGLSSILETE
MKIAFGNLWMEILYLKPPWTLLHLLQCFKKHWLAVFGLVMEKNLLLTIES
LYKNLRKANKAVDFTTVKFLLQDSRSLLHAFSTRSNYDGILPQTFAQVNN
LLQTFAEVKTKLKPNSSENTVTKKQEGTSLKNSHNQEITVFSSSHLPQPS
RHQEIWSILESVWITIYQNSTDVFQRLGSNSALTTSNIASFEEAFICLQK
LMAAVRDILEGIQRILAPNSNYQDVETLYNFLIKYEVNKNVKFTAQEIYD
CVSQTEYREKLTIGCRQLVEMEYTMQQCNASVYMEAKNRGWCEDMLNYRI

Transcriptional protein SWT1 (Homo sapiens) is product of expression of SWT1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Cloning and characterization of 13 novel transcripts and the human RGS8 gene from the 1q25 region encompassing the hereditary prostate cancer (HPC1) locus. Sood R, Bonner TI, Makalowska I, Stephan DA, Robbins CM, Connors TD, Morgenbesser SD, Su K, Faruque MU, Pinkett H, Graham C, Baxevanis AD, Klinger KW, Landes GM, Trent JM, Carpten JD Genomics 2001-04-15 (73) 11318611
The DNA sequence and biological annotation of human chromosome 1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC Nature 2006-05-18 (441) 16710414



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.