Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Transcriptional protein SWT1

 
Known also as: Synthetically lethal with TREX protein 1

Known abbreviations: SWT1,YOR166C, O3595

 

FUNCTION:
 
Involved in transcription. Probably fuctions as a transcriptional activator. 
 
SUBUNIT STRUCTURE:
 
Interacts with the TREX complex and RNA polymerase II. 
 
CELLULAR LOCALIZATION:
 
Nucleus. Note: Mainly nuclear, but might shuttle between the nucleus and the cytoplasm. 
 



NCBI GI number(s): 398365521
398365520
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q12104 Q12104
BRENDA - -
KEGG sce:YOR166C sce:YOR166C
PFAM: - Q12104 (Link - using uniprot id)
InterPro: IPR006596
IPR006596
CATH: - -
SCOP: - -


Protein sequence:
MTDEKRAFPKGNNHIRSETFNGSVSHKISESIKDIASLRPHGKYTVQDID
NIIASTSSHENRGQSGDSNGCINHDEEGDIPMCDLNDESDVEMISEYLSS
QREMEAQSVANYMPKINDDLPLLNPPTLKTAFVVDTNFIISHLNTLEKLR
SLSSTYHHLIIVPTTVIQELDGLKKSPDIARDNDDTTNQEHDRTIGTLAR
WGNDWIYKNLANLDSGLIGQKLKQSLNPGSLKDDSILDCCLYFKEILNCF
VILLSNDKNLCTKALTEDILTVSFRKNMDAKIIAMRAYEENQLRFANLRD
STVNNFDQNVTSYAHIPGIETPPLQFDKVSQNVFEQVKETIFFAIDHTLR
KEYGEDIGFIDYNPDKLTTIENASNYIYLFWVSVFSELFTCSKIKKNEWK
SLPTVLKSKPTNLNDLRTFEQFWETVLHFLFSKFTNEEKQSLEKQIHEWK
TSINAIST

Transcriptional protein SWT1 (Saccharomyces cerevisiae) is product of expression of SWT1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. Nature 1997-05-01 (387) 9169874
Analysis of a 22,956 bp region on the right arm of Saccharomyces cerevisiae chromosome XV. Madania A, Poch O, Tarassov I, Winsor B, Martin R Yeast 1996-12-01 (12) 8972579
Swt1, a novel yeast protein, functions in transcription. Rother S, Clausing E, Kieser A, Strasser K J Biol Chem 2006-12-01 (281) 17030511
Transcriptional activators in yeast. Titz B, Thomas S, Rajagopala SV, Chiba T, Ito T, Uetz P Nucleic Acids Res 2006-01-01 (34) 16464826



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.