Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

DIS3-like exonuclease 1

 
Known abbreviations: DIS3L, DIS3L1, KIAA1955

FUNCTION:

 
Putative cytoplasm-specific catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA.
 
COFACTOR:
 
Magnesium. 
 
SUBUNIT STRUCTURE:
 
Component of the RNA exosome complex. The catalytically inactive RNA exosome core (Exo-9) complex is believed to associate with catalytic subunits EXOSC10, and DIS3 or DIS3L in cytoplasmic- and nuclear-specific RNA exosome complex forms.
 
CELLULAR LOCALIZATION:
 
Cytoplasm



This protein can be a part of a given complexes: Activities in which DIS3-like exonuclease 1 is involved: Pathways in which DIS3-like exonuclease 1 is involved:

NCBI GI number(s): 219521928
219521927
19115966
219555681
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q8TF46 Q8TF46
BRENDA - -
KEGG hsa:115752 hsa:115752
PFAM: PF00773
PF00773
InterPro: IPR001900
IPR022966
IPR001900
IPR022966
CATH: - -
SCOP: - -


Protein sequence:
MLQKREKVLLLRTFQGRTLRIVREHYLRPCVPCHSPLCPQPAACSHDGKL
LSSDVTHYVIPDWKVVQDYLEILEFPELKGIIFMQTACQAVQHQRGRRQY
NKLRNLLKDARHDCILFANEFQQCCYLPRERGESMEKWQTRSIYNAAVWY
YHHCQDRMPIVMVTEDEEAIQQYGSETEGVFVITFKNYLDNFWPDLKAAH
ELCDSILQSRRERENESQESHGKEYPEHLPLEVLEAGIKSGRYIQGILNV
NKHRAQIEAFVRLQGASSKDSDLVSDILIHGMKARNRSIHGDVVVVELLP
KNEWKGRTVALCENDCDDKASGESPSEPMPTGRVVGILQKNWRDYVVTFP
SKEEVQSQGKNAQKILVTPWDYRIPKIRISTQQAETLQDFRVVVRIDSWE
STSVYPNGHFVRVLGRIGDLEGEIATILVENSISVIPFSEAQMCEMPVNT
PESPWKVSPEEEQKRKDLRKSHLVFSIDPKGCEDVDDTLSVRTLNNGNLE
LGVHIADVTHFVAPNSYIDIEARTRATTYYLADRRYDMLPSVLSADLCSL
LGGVDRYAVSIMWELDKASYEIKKVWYGRTIIRSAYKLFYEAAQELLDGN
LSVVDDIPEFKDLDEKSRQAKLEELVWAIGKLTDIARHVRAKRDGCGALE
LEGVEVCVQLDDKKNIHDLIPKQPLEVHETVAECMILANHWVAKKIWESF
PHQALLRQHPPPHQEFFSELRECAKAKGFFIDTRSNKTLADSLDNANDPH
DPIVNRLLRSMATQAMSNALYFSTGSCAEEEFHHYGLALDKYTHFTSPIR
RYSDIVVHRLLMAAISKDKKMEIKGNLFSNKDLEELCRHINNRNQAAQHS
QKQSTELFQCMYFKDKDPATEERCISDGVIYSIRTNGVLLFIPRFGIKGA
AYLKNKDGLVISCGPDSCSEWKPGSLQRFQNKITSTTTDGESVTFHLFDH
VTVRISIQASRCHSDTIRLEIISNKPYKIPNTELIHQSSPLLKSELVKEV
TKSVEEAQLAQEVKVNIIQEEYQEYRQTKGRSLYTLLEEIRDLALLDVSN
NYGI

DIS3-like exonuclease 1 (Homo sapiens) is product of expression of DIS3L gene.

DIS3-like exonuclease 1 (Homo sapiens) belongs to following protein families:


Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.