Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Histone RNA hairpin-binding protein

 
Known also as: Histone stem-loop-binding protein

Known abbreviations: SLBP, HBP

 

FUNCTION:
 
RNA-binding protein involved in the histone pre-mRNA processing. Binds the stem-loop structure of replication-dependent histone pre-mRNAs and contributes to efficient 3'-end processing by stabilizing the complex between histone pre-mRNA and U7 small nuclear ribonucleoprotein (snRNP), via the histone downstream element (HDE). Plays an important role in targeting mature histone mRNA from the nucleus to the cytoplasm and to the translation machinery. Stabilizes mature histone mRNA and could be involved in cell-cycle regulation of histone gene expression. Involved in the mechanism by which growing oocytes accumulate histone proteins that support early embryogenesis. Binds to the 5' side of the stem-loop structure of histone pre-mRNAs. 
 
SUBUNIT STRUCTURE:
 
Monomer. SLBP/pre-mRNA complex interacts with ZNF473. Interacts with the Importin alpha/Importin beta receptor, LSM1, MIF4GD, TNPO3 and UPF1. Interaction with LSM1 occurs when histone mRNA is being rapidly degraded during the S phase. Found in a ternary complex with ERI1 and the stem-loop structure of the 3' end of histone mRNA. Associates with polyribosomes. Identified in a histone pre-mRNA complex, at least composed of ERI1, LSM11, SLBP, SNRPB, SYNCRIP and YBX1 By similarity. Binds in a cooperative manner with ERI1 to the mature 3'-end of histone mRNAs (By similarity.)
 
CELLULAR LOCALIZATION:
 
Cytoplasm. Nucleus. Note: Polyribosome-associated. Localizes predominantly in the nucleus at the G1/G2 phases and the beginning of S phase. Through the S phase, partially redistributes to the cytoplasm. Binding to histone mRNA is necessary for cytoplasmic localization. Shuttles between the nucleus and the cytoplasm. Imported in the nucleus by the Importin alpha/Importin beta receptor. 
 
TISSUE SPECIFICITY:
 
Widely expressed.
 
DEVELOPMENTAL STAGE:
 
Regulated during the cell cycle: protein levels increase 10 to 20 fold in the late G1 and decrease at the S/G2 border.
 
DOMAIN:
 
Amino acids 31-34, 96-99 and 241-244 are necessary for interaction with the Importin alpha/Importin beta receptor. The first 18 amino acids, amino acids 69-76 and 179-182 are necessary for interaction with TNPO3. Amino acids 31-34, 96-99 and 241-244 are necessary for nuclear localization.
 
POST-TRANSLATIONAL MODIFICATION:
 
Phosphorylated on Thr-61 and Thr-62 in the S-phase. Phosphorylation of Thr-62 by CDK1 primes phosphorylation of Thr-61 by CK2. Phosphorylation of Thr-62 is required for its degradation by the proteasome at the end of the S phase. Its degradation is not required for histone mRNA degradation at the end of the S phase. All the phosphorylated forms detected are present in the cytoplasm. Both unphosphorylated and phosphorylated forms bind the stem-loop structure of histone mRNAs.
 



Activities in which Histone RNA hairpin-binding protein is involved: Pathways in which Histone RNA hairpin-binding protein is involved:

NCBI GI number(s): 5729862
19913344
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q14493 Q14493
BRENDA - -
KEGG hsa:7884 hsa:7884
PFAM: - Q14493 (Link - using uniprot id)
InterPro: - Q14493 (Link - using uniprot id)
CATH: - -
SCOP: - -


Protein sequence:
MACRPRSPPRHQSRCDGDASPPSPARWSLGRKRRADGRRWRPEDAEEAEH
RGAERRPESFTTPEGPKPRSRCSDWASAVEEDEMRTRVNKEMARYKRKLL
INDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQKQINYGKNTIA
YDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPP
AEEGCDLQEIHPVDLESAESSSEPQTSSQDDFDVYSGTPTKVRHMDSQVE
DEFDLEACLTEPLRDFSAMS

Histone RNA hairpin-binding protein (Homo sapiens) is product of expression of SLBP gene.



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.