Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Exosome complex component SKI6

 
Known also as: Extracellular mutant protein 20, Ribosomal RNA-processing protein 41, Superkiller protein 6

Known abbreviations: Ski6, Rrp41


FUNCTION:

Exosome component without exonuclease activity (PMID: 17942686).
  • required for degradation of 3'-end of the 7S pre-RNA to generate mature 5.8S (S) rRNA and 5.8S(L) rRNA (cleavage at site C2 in 3'-5' direction) (PMID:9390555, 10508172, 9891085, 9463390),
  • involved in 60S ribosome assembly (PMID: 9566888),
  • required for degradation of 5' end of the 35S pre-rRNA in 3'-5' direction (cleavage at site A0) (PMID: 9463390, 10465791),
  • necessary for translation blocking (PMID: 9566888) and digestion of nonpoly(A) mRNAs in 3'-5' direction (PMID: 9390555, 9482746, 10611222 ),
  • processing of 3' end of U1 snRNA (PMID: 10508172),
  • processing of 3' end of U4 snRNA (PMID: 10611222, 10508172),
  • processing of 3' end of U5 snRNA (PMID: 10508172),
  • processing of 3' end of snoRNA (PMID: 10611222)

REACTION:

tRNAn+1 + phosphate = tRNAn + a nucleoside diphosphate (BRENDA)

CELLULAR LOCALIZATION:

  • cytoplasmic exosome (RNase complex) (PMID: 10465791)
  • nuclear exosome (RNase complex) (PMID: 10465791)

DOMAIN ARCHITECTURE:

protein lenght: 246 aa (UniProt)
PH_domain1: 21 - 153(InterPro)
PH_domain2: 50 - 235

SUBUNIT STRUCTURE:

Component of the RNA exosome complex. Specifically part of the catalytically inactive RNA exosome core (Exo-9) complex which associates with catalytic subunits DIS3 and RRP6 in cytoplasmic- and nuclear-specific RNA exosome complex forms. Exo-9 is formed by a hexameric ring of RNase PH domain-containing subunits and peripheral S1 domain-containing components CSL4, RRP4 and RRP40 located on the top of the ring structure.



This protein can be a part of a given complexes:
NCBI GI number(s): 1176073
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P46948 P46948
BRENDA - -
KEGG sce:YGR195W sce:YGR195W
PFAM: PF01138
PF03725
PF01138
PF03725
InterPro: IPR001247
IPR015847
IPR020568
IPR001247
IPR015847
IPR020568
CATH: - -
SCOP: - -
Solved crystal structures: 2WP8
[PDB] [details]


Protein sequence:
MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKII
TLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEI
QTSLVRMFEKNVMLNIYPRTVIDIEIHVLEQDGGIMGSLINGITLALIDA
GISMFDYISGISVGLYDTTPLLDTNSLEENAMSTVTLGVVGKSEKLSLLL
VEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRVSNASAR

Exosome complex component SKI6 (Saccharomyces cerevisiae) is product of expression of SKI6 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Reconstitution, activities, and structure of the eukaryotic RNA exosome. Liu Q, Greimann JC, Lima CD Cell 2006-12-15 (127) 17174896
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The exosome: a conserved eukaryotic RNA processing complex containing multiple 3'-->5' exoribonucleases. Mitchell P, Petfalski E, Shevchenko A, Mann M, Tollervey D Cell 1997-11-14 (91) 9390555
The yeast exosome and human PM-Scl are related complexes of 3' --> 5' exonucleases. Allmang C, Petfalski E, Podtelejnikov A, Mann M, Tollervey D, Mitchell P Genes Dev 1999-08-15 (13) 10465791
Ski6p is a homolog of RNA-processing enzymes that affects translation of non-poly(A) mRNAs and 60S ribosomal subunit biogenesis. Benard L, Carroll K, Valle RC, Wickner RB Mol Cell Biol 1998-05-01 (18) 9566888
The nucleotide sequence of Saccharomyces cerevisiae chromosome VII. Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K Nature 1997-05-01 (387) 9169869
A single subunit, Dis3, is essentially responsible for yeast exosome core activity. Dziembowski A, Lorentzen E, Conti E, Seraphin B Nat Struct Mol Biol 2007-02-01 (14) 17173052
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
The yeast exosome functions as a macromolecular cage to channel RNA substrates for degradation. Bonneau F, Basquin J, Ebert J, Lorentzen E, Conti E Cell 2009-10-01 (139) 19879841
The complete sequence of a 9000 bp fragment of the right arm of Saccharomyces cerevisiae chromosome VII contains four previously unknown open reading frames. Guerreiro P, Silva AM, Barreiros T, Arroyo J, Garcia-Gonzalez M, Garcia-Saez MI, Rodrigues-Pousada C, Nombela C Yeast 1995-09-15 (11) 7502584



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-01-18 13:23:39
Edited by a user: kaja
Edited content: Changed description.

Welcome stranger! Click here to login or here to register.