Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Zinc finger protein 473

 
Known also as: Zinc finger protein 100 homolog

Known abbreviations: Zfp-100, ZNF473, KIAA1141, ZFP100

 

FUNCTION:
 
Involved in histone 3'-end pre-mRNA processing by associating with U7 snRNP and interacting with SLBP/pre-mRNA complex. Increases histone 3'-end pre-mRNA processing but has no effect on U7 snRNP levels, when overexpressed. Required for cell cycle progression from G1 to S phases. 
 
SUBUNIT STRUCTURE:
 
Interacts with the SLBP/pre-mRNA complex but not with SLBP alone. Interacts with LSM11 in a U7 snRNP-dependent manner. 
 
CELLULAR LOCALIZATION:
 
Nucleus. Note: Stable component of Cajal bodies (CBs). Colocalizes with SMN, coilin and U7 snRNA.
 
DOMAIN:
 
The C2H2-type zinc finger 2 to 6 are necessary and sufficient for discrete Cajal bodies localization. The C2H2-type zinc finger 5 to 10 are necessary and sufficient for interaction with LSM11. The C2H2-type zinc finger 2 to 8 are necessary for interaction with the SLBP/RNA complex in the histone pre-mRNAs. The C2H2-type zinc finger 2 to 10 confer activity in histone pre-mRNA processing.



Activities in which Zinc finger protein 473 is involved: Pathways in which Zinc finger protein 473 is involved:

NCBI GI number(s): 54792150
54792149
54792148
54792147
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q8WTR7 Q8WTR7
BRENDA - -
KEGG hsa:25888 hsa:25888
PFAM: PF01352
PF00096
PF01352
PF00096
InterPro: IPR001909
IPR007087
IPR015880
IPR013087
IPR001909
IPR007087
IPR015880
IPR013087
CATH: - -
SCOP: - -


Protein sequence:
MAEEFVTLKDVGMDFTLGDWEQLGLEQGDTFWDTALDNCQDLFLLDPPRP
NLTSHPDGSEDLEPLAGGSPEATSPDVTETKNSPLMEDFFEEGFSQEIIE
MLSKDGFWNSNFGEACIEDTWLDSLLGDPESLLRSDIATNGESPTECKSH
ELKRGLSPVSTVSTGEDSMVHNVSEKTLTPAKSKEYRGEFFSYSDHSQQD
SVQEGEKPYQCSECGKSFSGSYRLTQHWITHTREKPTVHQECEQGFDRNA
SLSVYPKTHTGYKFYVCNEYGTTFSQSTYLWHQKTHTGEKPCKSQDSDHP
PSHDTQPGEHQKTHTDSKSYNCNECGKAFTRIFHLTRHQKIHTRKRYECS
KCQATFNLRKHLIQHQKTHAAKTTSECQECGKIFRHSSLLIEHQALHAGE
EPYKCNERGKSFRHNSTLKIHQRVHSGEKPYKCSECGKAFHRHTHLNEHR
RIHTGYRPHKCQECVRSFSRPSHLMRHQAIHTAEKPYSCAECKETFSDNN
RLVQHQKMHTVKTPYECQECGERFICGSTLKCHESVHAREKQGFFVSGKI
LDQNPEQKEKCFKCNKCEKTFSCSKYLTQHERIHTRGVKPFECDQCGKAF
GQSTRLIHHQRIHSRVRLYKWGEQGKAISSASLIKLQSFHTKEHPFKCNE
CGKTFSHSAHLSKHQLIHAGENPFKCSKCDRVFTQRNYLVQHERTHARKK
PLVCNECGKTFRQSSCLSKHQRIHSGEKPYVCDYCGKAFGLSAELVRHQR
IHTGEKPYVCQECGKAFTQSSCLSIHRRVHTGEKPYRCGECGKAFAQKAN
LTQHQRIHTGEKPYSCNVCGKAFVLSAHLNQHLRVHTQETLYQCQRCQKA
FRCHSSLSRHQRVHNKQQYCL

Zinc finger protein 473 (Homo sapiens) is product of expression of ZNF473 gene.



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.