Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Polyribonucleotide 5'-hydroxyl-kinase Clp1

 
Known also as: Polynucleotide kinase Clp1, Pre-mRNA cleavage complex II protein Clp1

Known abbreviations: CLP1,HEAB

 

 
FUNCTION:
Polynucleotide kinase that can phosphorylate the 5'-hydroxyl groups of double-stranded RNA (dsRNA), single-stranded RNA (ssRNA), double stranded DNA (dsDNA) and double-stranded DNA:RNA hybrids. dsRNA is phosphorylated more efficiently than dsDNA, and the RNA component of a DNA:RNA hybrid is phosphorylated more efficiently than the DNA component. Appears to have roles in both tRNA splicing and mRNA 3'-end formation. Component of the tRNA splicing endonuclease complex. Phosphorylates the 5'-terminus of the tRNA 3'-exon during tRNA splicing; this phosphorylation event is a prerequisite for the subsequent ligation of the two exon halves and the production of a mature tRNA. Component of the pre-mRNA cleavage complex II (CF-II), which seems to be required for mRNA 3'-end formation. Also phosphorylates the 5'-terminus of exogenously introduced short interfering RNAs (siRNAs), which is a necessary prerequisite for their incorporation into the RNA-induced silencing complex (RISC). However, endogenous siRNAs and microRNAs (miRNAs) that are produced by the cleavage of dsRNA precursors by DICER1 already contain a 5'-phosphate group, so this protein may be dispensible for normal RNA-mediated gene silencing. Ref.7 Ref.8
CATALYTIC ACTIVITY:
 
ATP + 5'-dephospho-DNA = ADP + 5'-phospho-DNA. 
ATP + 5'-dephospho-RNA = ADP + 5'-phospho-RNA. 
 
COFACTOR:
 
Magnesium, manganese or nickel. 
 
SUBUNIT STRUCTURE:
 
Component of the tRNA splicing endonuclease complex, composed of CLP1, TSEN2, TSEN15, TSEN34 and TSEN54. Component of pre-mRNA cleavage complex II (CF-II). Also associates with numerous components of the pre-mRNA cleavage complex I (CF-I/CFIm), including NUDT21, CPSF2, CPSF3, CPSF6 and CPSF7. Interacts with CSTF2 and SYMPK.
 
CELLULAR LOCALIZATION:
 
Nucleus 



This protein can be a part of a given complexes: Activities in which Polyribonucleotide 5'-hydroxyl-kinase Clp1 is involved: Pathways in which Polyribonucleotide 5'-hydroxyl-kinase Clp1 is involved:

NCBI GI number(s): 217272859
217272858
5803029
217272857
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q92989 Q92989
BRENDA - -
KEGG hsa:10978 hsa:10978
PFAM: PF06807
PF06807
InterPro: IPR010655
IPR010655
CATH: - -
SCOP: - -


Protein sequence:
MGEEANDDKKPTTKFELERETELRFEVEASQSVQLELLTGMAEIFGTELT
RNKKFTFDAGAKVAVFTWHGCSVQLSGRTEVAYVSKDTPMLLYLNTHTAL
EQMRRQAEKEEERGPRVMVVGPTDVGKSTVCRLLLNYAVRLGRRPTYVEL
DVGQGSVSIPGTMGALYIERPADVEEGFSIQAPLVYHFGSTTPGTNIKLY
NKITSRLADVFNQRCEVNRRASVSGCVINTCGWVKGSGYQALVHAASAFE
VDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDER
IREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQL
KLVPVTPGRDMVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDLEHQVFT
VLSPAPRPLPKNFLLIMDIRFMDLK

Polyribonucleotide 5'-hydroxyl-kinase Clp1 (Homo sapiens) is product of expression of CLP1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Identification of a human endonuclease complex reveals a link between tRNA splicing and pre-mRNA 3' end formation. Paushkin SV, Patel M, Furia BS, Peltz SW, Trotta CR Cell 2004-04-01 (117) 15109492
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
The human RNA kinase hClp1 is active on 3' transfer RNA exons and short interfering RNAs. Weitzer S, Martinez J Nature 2007-05-10 (447) 17495927
Human pre-mRNA cleavage factor II(m) contains homologs of yeast proteins and bridges two other cleavage factors. de Vries H, Ruegsegger U, Hubner W, Friedlein A, Langen H, Keller W EMBO J 2000-11-01 (19) 11060040
AF10 is split by MLL and HEAB, a human homolog to a putative Caenorhabditis elegans ATP/GTP-binding protein in an invins(10;11)(p12;q23q12). Tanabe S, Bohlander SK, Vignon CV, Espinosa R 3rd, Zhao N, Strissel PL, Zeleznik-Le NJ, Rowley JD Blood 1996-11-01 (88) 8896421
Human RNA 5'-kinase (hClp1) can function as a tRNA splicing enzyme in vivo. Ramirez A, Shuman S, Schwer B RNA 2008-09-01 (14) 18648070



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.