Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Small nuclear ribonucleoprotein-associated proteins B and B'

 
Known also as: Sm protein B/B'

Known abbreviations: SNRPB, COD, SNRPB1, snRNP-B, Sm-B/B', SmB/B'

 

FUNCTION:
 
Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5. May have a functional role in the pre-mRNA splicing or in snRNP structure. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner (By similarity.)
 
SUBUNIT STRUCTURE:
 
Identified in a histone pre-mRNA complex, at least composed of ERI1, LSM11, SLBP, SNRPB, SYNCRIP and YBX1 By similarity. Component of the heptameric ring U7 snRNP complex, or U7 Sm protein core complex, at least composed of LSM10, LSM11, SNRPB, SNRPD3, SNRPE, SNRPF, SNRPG and U7 snRNA. Formation of the U7 snRNP is an ATP-dependent process mediated by a specialized SMN complex containing at least the Sm protein core complex and additionally, the U7-specific LSM10 and LSM11 proteins. Identified in the spliceosome C complex. Component of the U11/U12 snRNPs that are part of the U12-type spliceosome. Interacts with CLNS1A, DDX20, LSM11, TDRD3, SNUPN and SMN1. 
 
CELLULAR LOCALIZATION:
 
Nucleus.
 
POST-TRANSLATIONAL MODIFICATION:
 
Methylated. Arg-108 and Arg-112 are dimethylated, probably to asymmetric dimethylarginine.



This protein can be a part of a given complexes: Activities in which Small nuclear ribonucleoprotein-associated proteins B and B' is involved: Pathways in which Small nuclear ribonucleoprotein-associated proteins B and B' is involved:

NCBI GI number(s): 4507125
38149990
38150007
38150006
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot P14678 P14678
BRENDA - -
KEGG hsa:6628 hsa:6628
PFAM: PF01423
PF01423
InterPro: IPR010920
IPR001163
IPR006649
IPR017131
IPR010920
IPR001163
IPR006649
IPR017131
CATH: - -
SCOP: - -
Solved crystal structures: 1D3B
2Y9A
2Y9B
2Y9C
2Y9D
3CW1
3PGW
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRK
IKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGA
AGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTV
AAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMG
PPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Small nuclear ribonucleoprotein-associated proteins B and B' (Homo sapiens) is product of expression of SNRPB gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis. Jurica MS, Licklider LJ, Gygi SR, Grigorieff N, Moore MJ RNA 2002-04-01 (8) 11991638
Identifying and quantifying in vivo methylation sites by heavy methyl SILAC. Ong SE, Mittler G, Mann M Nat Methods 2004-11-01 (1) 15782174
The DNA sequence and comparative analysis of human chromosome 20. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, K Nature 2001-01-01 (414) 11780052
Unique Sm core structure of U7 snRNPs: assembly by a specialized SMN complex and the role of a new component, Lsm11, in histone RNA processing. Pillai RS, Grimmler M, Meister G, Will CL, Luhrmann R, Fischer U, Schumperli D Genes Dev 2003-09-15 (17) 12975319
Purified U7 snRNPs lack the Sm proteins D1 and D2 but contain Lsm10, a new 14 kDa Sm D1-like protein. Pillai RS, Will CL, Luhrmann R, Schumperli D, Muller B EMBO J 2001-10-01 (20) 11574479
Toward an assembly line for U7 snRNPs: interactions of U7-specific Lsm proteins with PRMT5 and SMN complexes. Azzouz TN, Pillai RS, Dapp C, Chari A, Meister G, Kambach C, Fischer U, Schumperli D J Biol Chem 2005-10-14 (280) 16087681
The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome. Will CL, Schneider C, Hossbach M, Urlaub H, Rauhut R, Elbashir S, Tuschl T, Luhrmann R RNA 2004-06-01 (10) 15146077
Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs. Kambach C, Walke S, Young R, Avis JM, de la Fortelle E, Raker VA, Luhrmann R, Li J, Nagai K Cell 1999-01-05 (96) 10025403
Cloned human snRNP proteins B and B' differ only in their carboxy-terminal part. van Dam A, Winkel I, Zijlstra-Baalbergen J, Smeenk R, Cuypers HT EMBO J 1989-12-01 (8) 2531083
A comparison of snRNP-associated Sm-autoantigens: human N, rat N and human B/B'. Schmauss C, McAllister G, Ohosone Y, Hardin JA, Lerner MR Nucleic Acids Res 1989-01-25 (17) 2522186
Molecular cloning of cDNA encoding Sm autoantigen: derivation of a cDNA for a B polypeptide of the U series of small nuclear ribonucleoprotein particles. Ohosone Y, Mimori T, Griffith A, Akizuki M, Homma M, Craft J, Hardin JA Proc Natl Acad Sci U S A 1989-06-01 (86) 2524838
Concerted regulation and molecular evolution of the duplicated SNRPB'/B and SNRPN loci. Gray TA, Smithwick MJ, Schaldach MA, Martone DL, Graves JA, McCarrey JR, Nicholls RD Nucleic Acids Res 1999-12-01 (27) 10556313
Epitope mapping of recombinant HeLa SmB and B' peptides obtained by the polymerase chain reaction. Elkon KB, Hines JJ, Chu JL, Parnassa A J Immunol 1990-07-15 (145) 1694885
The small nuclear ribonucleoproteins, SmB and B', are products of a single gene. Chu JL, Elkon KB Gene 1991-02-15 (97) 1825643
SMN, the spinal muscular atrophy protein, forms a pre-import snRNP complex with snurportin1 and importin beta. Narayanan U, Ospina JK, Frey MR, Hebert MD, Matera AG Hum Mol Genet 2002-07-15 (11) 12095920
Tudor domains bind symmetrical dimethylated arginines. Cote J, Richard S J Biol Chem 2005-08-05 (280) 15955813



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.