Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Small nuclear ribonucleoprotein Sm D3

 
Known also as: snRNP core protein D3

Known abbreviations: SNRPD3, Sm-D3

 

FUNCTION:
 
Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner. Ref.7
 
SUBUNIT STRUCTURE:
 
Component of the heptameric ring U7 snRNP complex, or U7 Sm protein core complex, at least composed of LSM10, LSM11, SNRPB, SNRPD3, SNRPE, SNRPF, SNRPG and U7 snRNA. Formation of the U7 snRNP is an ATP-dependent process mediated by a specialized SMN complex containing at least the Sm protein core complex and additionally, the U7-specific LSM10 and LSM11 proteins. Identified in the spliceosome C complex. Component of the U11/U12 snRNPs that are part of the U12-type spliceosome.
 
CELLULAR LOCALIZATION:
 
Nucleus.
 
POST-TRANSLATIONAL MODIFICATION:
 
Methylated on arginine residues by PRMT5 and PRMT7; methylation is required for assembly and biogenesis of snRNPs.
Arg-97 is dimethylated, probably to asymmetric dimethylarginine.



This protein can be a part of a given complexes: Activities in which Small nuclear ribonucleoprotein Sm D3 is involved: Pathways in which Small nuclear ribonucleoprotein Sm D3 is involved:

NCBI GI number(s): 4759160
34328935
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot P62318 P62318
BRENDA - -
KEGG hsa:6634 hsa:6634
PFAM: PF01423
PF01423
InterPro: IPR010920
IPR001163
IPR006649
IPR010920
IPR001163
IPR006649
CATH: - -
SCOP: - -
Solved crystal structures: 1D3B
2Y9A
2Y9B
2Y9C
2Y9D
3CW1
3PGW
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTY
RDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKA
AILKAQVAARGRGRGMGRGNIFQKRR

Small nuclear ribonucleoprotein Sm D3 (Homo sapiens) is product of expression of SNRPD3 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis. Jurica MS, Licklider LJ, Gygi SR, Grigorieff N, Moore MJ RNA 2002-04-01 (8) 11991638
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Identifying and quantifying in vivo methylation sites by heavy methyl SILAC. Ong SE, Mittler G, Mann M Nat Methods 2004-11-01 (1) 15782174
A genome annotation-driven approach to cloning the human ORFeome. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I Genome Biol 2004-01-01 (5) 15461802
Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N Nat Methods 2008-12-01 (5) 19054851
Purified U7 snRNPs lack the Sm proteins D1 and D2 but contain Lsm10, a new 14 kDa Sm D1-like protein. Pillai RS, Will CL, Luhrmann R, Schumperli D, Muller B EMBO J 2001-10-01 (20) 11574479
The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome. Will CL, Schneider C, Hossbach M, Urlaub H, Rauhut R, Elbashir S, Tuschl T, Luhrmann R RNA 2004-06-01 (10) 15146077
cDNA cloning of the Sm proteins D2 and D3 from human small nuclear ribonucleoproteins: evidence for a direct D1-D2 interaction. Lehmeier T, Raker V, Hermann H, Luhrmann R Proc Natl Acad Sci U S A 1994-12-06 (91) 7527560
Methylation of Sm proteins by a complex containing PRMT5 and the putative U snRNP assembly factor pICln. Meister G, Eggert C, Buhler D, Brahms H, Kambach C, Fischer U Curr Biol 2001-12-11 (11) 11747828
Two distinct arginine methyltransferases are required for biogenesis of Sm-class ribonucleoproteins. Gonsalvez GB, Tian L, Ospina JK, Boisvert FM, Lamond AI, Matera AG J Cell Biol 2007-08-27 (178) 17709427
Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs. Kambach C, Walke S, Young R, Avis JM, de la Fortelle E, Raker VA, Luhrmann R, Li J, Nagai K Cell 1999-01-05 (96) 10025403



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.