Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Small nuclear ribonucleoprotein F

 
Known also as: Sm protein F

Known abbreviations: SNRPF, PBSCF, SmF, Sm-F, snRNP-F

 

FUNCTION:
 
Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5.
 
SUBUNIT STRUCTURE:
 
Component of the heptameric ring U7 snRNP complex, or U7 Sm protein core complex, at least composed of LSM10, LSM11, SNRPB, SNRPD3, SNRPE, SNRPF, SNRPG and U7 snRNA. Formation of the U7 snRNP is an ATP-dependent process mediated by a specialized SMN complex containing at least the Sm protein core complex and additionally, the U7-specific LSM10 and LSM11 proteins. Identified in the spliceosome C complex. Component of the U11/U12 snRNPs that are part of the U12-type spliceosome.
 
CELLULAR LOCALIZATION:
 
Nucleus.



This protein can be a part of a given complexes: Activities in which Small nuclear ribonucleoprotein F is involved: Pathways in which Small nuclear ribonucleoprotein F is involved:

NCBI GI number(s): 4507131
83776586
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot P62306 P62306
BRENDA - -
KEGG hsa:6636 hsa:6636
PFAM: PF01423
PF01423
InterPro: IPR010920
IPR001163
IPR006649
IPR016487
IPR010920
IPR001163
IPR006649
IPR016487
CATH: - -
SCOP: - -
Solved crystal structures: 2Y9A
2Y9B
2Y9C
2Y9D
3CW1
3PGW
3S6N
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY
IDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Small nuclear ribonucleoprotein F (Homo sapiens) is product of expression of SNRPF gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis. Jurica MS, Licklider LJ, Gygi SR, Grigorieff N, Moore MJ RNA 2002-04-01 (8) 11991638
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Purified U7 snRNPs lack the Sm proteins D1 and D2 but contain Lsm10, a new 14 kDa Sm D1-like protein. Pillai RS, Will CL, Luhrmann R, Schumperli D, Muller B EMBO J 2001-10-01 (20) 11574479
snRNP Sm proteins share two evolutionarily conserved sequence motifs which are involved in Sm protein-protein interactions. Hermann H, Fabrizio P, Raker VA, Foulaki K, Hornig H, Brahms H, Luhrmann R EMBO J 1995-05-01 (14) 7744013
The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome. Will CL, Schneider C, Hossbach M, Urlaub H, Rauhut R, Elbashir S, Tuschl T, Luhrmann R RNA 2004-06-01 (10) 15146077



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.