Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Cleavage stimulation factor subunit 1

 
Known also as: CSTF 50 kDa subunit, CF-1 50 kDa subunit, Cleavage stimulation factor 50 kDa subunit

Known abbreviations: CSTF1, CstF-50

 

FUNCTION:
One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. May be responsible for the interaction of CSTF with other factors to form a stable complex on the pre-mRNA.
 
SUBUNIT STRUCTURE:
 
Homodimer. The CSTF complex is composed of CSTF1 (50 kDa subunit), CSTF2 (64 kDa subunit) and CSTF3 (77 kDa subunit). Interacts directly with CSTF3. Interacts with BARD1.
 
CELLULAR LOCALIZATION:
 
Nucleus.
 
DOMAIN:
 
The WD6 domain is required for interaction with BARD1. WD domains are responsible for interaction with CSTF3.
N-terminus mediates homodimerization.
 
POST-TRANSLATIONAL MODIFICATION:
 
The N-terminus is blocked.



This protein can be a part of a given complexes: Activities in which Cleavage stimulation factor subunit 1 is involved: Pathways in which Cleavage stimulation factor subunit 1 is involved:

NCBI GI number(s): 75709217
75709216
75709220
75709219
4557491
75709218
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q05048 Q05048
BRENDA - -
KEGG hsa:1477 hsa:1477
PFAM: PF00400
PF00400
InterPro: IPR015943
IPR001680
IPR019775
IPR017986
IPR015943
IPR001680
IPR019775
IPR017986
CATH: - -
SCOP: - -


Protein sequence:
MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQL
LHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYE
TCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEV
MMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLF
DYSKPSAKRAFKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQ
CFVSCNPQDQHTDAICSVNYNSSANMYVTGSKDGCIKLWDGVSNRCITTF
EKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLS
GRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIV
RCIVHSPTNPGFMTCSDDFRARFWYRRSTTD

Cleavage stimulation factor subunit 1 (Homo sapiens) is product of expression of CSTF1 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ Nat Biotechnol 2005-02-01 (23) 15592455
The DNA sequence and comparative analysis of human chromosome 20. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, K Nature 2001-01-01 (414) 11780052
Functional interaction of BRCA1-associated BARD1 with polyadenylation factor CstF-50. Kleiman FE, Manley JL Science 1999-09-03 (285) 10477523
A human polyadenylation factor is a G protein beta-subunit homologue. Takagaki Y, Manley JL J Biol Chem 1992-11-25 (267) 1358884
Complex protein interactions within the human polyadenylation machinery identify a novel component. Takagaki Y, Manley JL Mol Cell Biol 2000-03-01 (20) 10669729



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.