Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Cleavage stimulation factor subunit 2

 
Known also as: CF-1 64 kDa subunit,Cleavage stimulation factor 64 kDa subunit,CSTF 64 kDa subunit

Known abbreviations: CstF-64

 

FUNCTION:
 
One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. This subunit is directly involved in the binding to pre-mRNAs By similarity. 
 
SUBUNIT STRUCTURE:
 
The CSTF complex is composed of CSTF1 (50 kDa subunit), CSTF2 (64 kDa subunit) and CSTF3 (77 kDa subunit). CSTF2 directly interacts with CSTF3, SYMPK and RPO2TC1. Interacts with HSF1 in heat-stressed cells. Interacts with CPSF2, CPSF3 and FIP1L1. Interacts with DDX1. 
 
CELLULAR LOCALIZATION:
 
Nucleus. Note: Localized with DDX1 in cleavage bodies
INDUCTION:
 
Up-regulated during the G0 to S phase transition.
 
POST-TRANSLATIONAL MODIFICATION:
 
Phosphorylated upon DNA damage, probably by ATM or ATR. 



This protein can be a part of a given complexes: Activities in which Cleavage stimulation factor subunit 2 is involved: Pathways in which Cleavage stimulation factor subunit 2 is involved:

NCBI GI number(s): 4557493
75813621
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot P33240 P33240
BRENDA - -
KEGG hsa:1478 hsa:1478
PFAM: PF14327
PF00076
PF14327
PF00076
InterPro: IPR025742
IPR012677
IPR000504
IPR025742
IPR012677
IPR000504
CATH: - -
SCOP: - -
Solved crystal structures: 1P1T
2J8P
[PDB] [details]
[PDB] [details]


Protein sequence:
MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYD
RETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE
LKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQMFELMKQMKLC
VQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTNIPTL
IAGNPQPVHGAGPGSGSNVSMNQQNPQAPQAQSLGGMHVNGAPPLMQASM
QGGVPAPGQMPAAVTGPGPGSLAPGGGMQAQVGMPGSGPVSMERGQVPMQ
DPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPP
HQGPPMHHVPGHESRGPPPHELRGGPLPEPRPLMAEPRGPMLDQRGPPLD
GRGGRDPRGIDARGMEARAMEARGLDARGLEARAMEARAMEARAMEARAM
EARAMEVRGMEARGMDTRGPVPGPRGPIPSGMQGPSPINMGAVVPQGSRQ
VPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHEKAALIMQVLQLTAD
QIAMLPPEQRQSILILKEQIQKSTGAP

Cleavage stimulation factor subunit 2 (Homo sapiens) is product of expression of CSTF2 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S Anal Chem 2009-06-01 (81) 19413330
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ Science 2007-05-25 (316) 17525332
A quantitative atlas of mitotic phosphorylation. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP Proc Natl Acad Sci U S A 2008-08-05 (105) 18669648
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK Sci Signal 2009-01-01 (2) 19690332
Association of human DEAD box protein DDX1 with a cleavage stimulation factor involved in 3'-end processing of pre-MRNA. Bleoo S, Sun X, Hendzel MJ, Rowe JM, Packer M, Godbout R Mol Biol Cell 2001-10-01 (12) 11598190
Human Fip1 is a subunit of CPSF that binds to U-rich RNA elements and stimulates poly(A) polymerase. Kaufmann I, Martin G, Friedlein A, Langen H, Keller W EMBO J 2004-01-11 (23) 14749727
Conserved motifs in both CPSF73 and CPSF100 are required to assemble the active endonuclease for histone mRNA 3'-end maturation. Kolev NG, Yario TA, Benson E, Steitz JA EMBO Rep 2008-10-01 (9) 18688255
The poly A polymerase Star-PAP controls 3'-end cleavage by promoting CPSF interaction and specificity toward the pre-mRNA. Laishram RS, Anderson RA EMBO J 2010-12-15 (29) 21102410
The human 64-kDa polyadenylylation factor contains a ribonucleoprotein-type RNA binding domain and unusual auxiliary motifs. Takagaki Y, MacDonald CC, Shenk T, Manley JL Proc Natl Acad Sci U S A 1992-01-15 (89) 1741396
Recognition of GU-rich polyadenylation regulatory elements by human CstF-64 protein. Perez Canadillas JM, Varani G EMBO J 2003-06-02 (22) 12773396
The C-terminal domains of vertebrate CstF-64 and its yeast orthologue Rna15 form a new structure critical for mRNA 3'-end processing. Qu X, Perez-Canadillas JM, Agrawal S, De Baecke J, Cheng H, Varani G, Moore C J Biol Chem 2007-02-19 (282) 17116658
Complex protein interactions within the human polyadenylation machinery identify a novel component. Takagaki Y, Manley JL Mol Cell Biol 2000-03-01 (20) 10669729
The DNA sequence of the human X chromosome. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin Nature 2005-03-17 (434) 15772651
RNA recognition by the human polyadenylation factor CstF. Takagaki Y, Manley JL... Mol Cell Biol 1997-07-01 (17) 9199325
Increase in the 64-kDa subunit of the polyadenylation/cleavage stimulatory factor during the G0 to S phase transition. Martincic K, Campbell R, Edwalds-Gilbert G, Souan L, Lotze MT, Milcarek C... Proc Natl Acad Sci U S A 1998-09-15 (95) 9736695
Evolutionarily conserved interaction between CstF-64 and PC4 links transcription, polyadenylation, and termination. Calvo O, Manley JL... Mol Cell 2001-05-01 (7) 11389848
HSF1 modulation of Hsp70 mRNA polyadenylation via interaction with symplekin. Xing H, Mayhew CN, Cullen KE, Park-Sarge OK, Sarge KD... J Biol Chem 2004-03-12 (279) 14707147



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.