|
Known also as: Cleavage and polyadenylation specificity factor 25 kDa subunit, CPSF 25 kDa subunit, Nucleoside diphosphate-linked moiety X motif 21, Nudix motif 21, Pre-mRNA cleavage factor Im 25 kDa subunit
Known abbreviations: NUDT21, CFIM25, CPSF25, CPSF5, CFIm25
FUNCTION:
Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing. Involved in association with CPSF6 or CPSF7 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. NUDT21/CPSF5 binds to cleavage and polyadenylation RNA substrates. The homodimer mediates simultaneous sequence-specific recognition of two 5'-UGUA-3' elements within the pre-mRNA. Binds to, but does not hydrolyze mono- and di-adenosine nucleotides. May have a role in mRNA export.
SUBUNIT STRUCTURE:
Homodimer. Component of the cleavage factor Im (CFIm) complex, composed of, at least, NUDT21/CPSF5 and CPSF6 or CPSF7. Within the cleavage factor Im complex, the NUDT21/CPSF5 homodimer is at the core of a heterotetramer, and is clasped by two additional subunits (CPSF6 or CPSF7). Interacts with CPSF6, CPSF7, PABPN1 and SNRNP70. Interacts with PAPOLA; the interaction is diminished by acetylation.
CELLULAR LOCALIZATION:
Nucleus. Note: In punctate subnuclear structures localized adjacent to nuclear speckles, called paraspeckles.
POST-TRANSLATIONAL MODIFICATION:
Acetylated mainly by p300/CBP, recruited to the complex by CPSF6. Acetylation decreases interaction with PAPAO. Deacetylated by the class I/II HDACs, HDAC1, HDAC3 and HDAC10, and by the class III HDACs, SIRT1 AND SIRT2.
|
This protein can be a part of a given complexes:
Activities in which Cleavage and polyadenylation specificity factor subunit 5 is involved:
Pathways in which Cleavage and polyadenylation specificity factor subunit 5 is involved:
Links to other databases:
Protein sequence:
MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTK
EPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLG
TTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWR
PNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFE
LYDNAPGYGPIISSLPQLLSRFNFIYN
|
Cleavage and polyadenylation specificity factor subunit 5 (Homo sapiens) is product of expression of
NUDT21
gene.
References:
Title |
Authors |
Journal
| Publication date (Issue)
| PubMed ID
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K |
Genome Res
|
2004-10-01 (14) |
15489334 |
Distinct sequence motifs within the 68-kDa subunit of cleavage factor Im mediate RNA binding, protein-protein interactions, and subcellular localization. |
Dettwiler S, Aringhieri C, Cardinale S, Keller W, Barabino SM |
J Biol Chem
|
2004-08-20 (279) |
15169763 |
Initial characterization of the human central proteome. |
Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J |
BMC Syst Biol
|
2011-01-01 (5) |
21269460 |
The full-ORF clone resource of the German cDNA Consortium. |
Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I |
BMC Genomics
|
2007-01-01 (8) |
17974005 |
Lysine acetylation targets protein complexes and co-regulates major cellular functions. |
Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M |
Science
|
2009-08-14 (325) |
19608861 |
Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. |
Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ |
Nat Biotechnol
|
2005-02-01 (23) |
15592455 |
The sequence and analysis of duplication-rich human chromosome 16. |
Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M |
Nature
|
2004-12-23 (432) |
15616553 |
Evidence that cleavage factor Im is a heterotetrameric protein complex controlling alternative polyadenylation. |
Kim S, Yamamoto J, Chen Y, Aida M, Wada T, Handa H, Yamaguchi Y |
Genes Cells
|
2010-09-01 (15) |
20695905 |
Association of polyadenylation cleavage factor I with U1 snRNP. |
Awasthi S, Alwine JC |
RNA
|
2003-11-01 (9) |
14561889 |
A mechanism for the regulation of pre-mRNA 3' processing by human cleavage factor Im. |
Brown KM, Gilmartin GM |
Mol Cell
|
2003-12-01 (12) |
14690600 |
Purification and characterization of human cleavage factor Im involved in the 3' end processing of messenger RNA precursors. |
Ruegsegger U, Beyer K, Keller W |
J Biol Chem
|
1996-03-15 (271) |
8626397 |
Multiple histone deacetylases and the CREB-binding protein regulate pre-mRNA 3'-end processing. |
Shimazu T, Horinouchi S, Yoshida M |
J Biol Chem
|
2007-01-16 (282) |
17172643 |
Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping. |
Yang Q, Coseno M, Gilmartin GM, Doublie S |
Structure
|
2011-03-09 (19) |
21295486 |
The crystal structure of human cleavage and polyadenylation specific factor-5 reveals a dimeric Nudix protein with a conserved catalytic site. |
Tresaugues L, Stenmark P, Schuler H, Flodin S, Welin M, Nyman T, Hammarstrom M, Moche M, Graslund S, Nordlund P |
Proteins
|
2008-12-01 (73) |
18767156 |
Crystal structure of the 25 kDa subunit of human cleavage factor Im. |
Coseno M, Martin G, Berger C, Gilmartin G, Keller W, Doublie S |
Nucleic Acids Res
|
2008-06-01 (36) |
18445629 |
Structural basis of UGUA recognition by the Nudix protein CFI(m)25 and implications for a regulatory role in mRNA 3' processing. |
Yang Q, Gilmartin GM, Doublie S |
Proc Natl Acad Sci U S A
|
2010-06-01 (107) |
20479262 |
Human pre-mRNA cleavage factor Im is related to spliceosomal SR proteins and can be reconstituted in vitro from recombinant subunits. |
Ruegsegger U, Blank D, Keller W |
Mol Cell
|
1998-02-01 (1) |
9659921 |
Add your own comment!
There are no comments yet.
Last modification of this entry: Sept. 25, 2012.
|