Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Cleavage and polyadenylation specificity factor subunit 5

 
Known also as: Cleavage and polyadenylation specificity factor 25 kDa subunit, CPSF 25 kDa subunit, Nucleoside diphosphate-linked moiety X motif 21, Nudix motif 21, Pre-mRNA cleavage factor Im 25 kDa subunit

Known abbreviations: NUDT21, CFIM25, CPSF25, CPSF5, CFIm25

 

FUNCTION:
 
Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing. Involved in association with CPSF6 or CPSF7 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. NUDT21/CPSF5 binds to cleavage and polyadenylation RNA substrates. The homodimer mediates simultaneous sequence-specific recognition of two 5'-UGUA-3' elements within the pre-mRNA. Binds to, but does not hydrolyze mono- and di-adenosine nucleotides. May have a role in mRNA export. 
 
SUBUNIT STRUCTURE:
 
Homodimer. Component of the cleavage factor Im (CFIm) complex, composed of, at least, NUDT21/CPSF5 and CPSF6 or CPSF7. Within the cleavage factor Im complex, the NUDT21/CPSF5 homodimer is at the core of a heterotetramer, and is clasped by two additional subunits (CPSF6 or CPSF7). Interacts with CPSF6, CPSF7, PABPN1 and SNRNP70. Interacts with PAPOLA; the interaction is diminished by acetylation. 
 
CELLULAR LOCALIZATION:
 
Nucleus. Note: In punctate subnuclear structures localized adjacent to nuclear speckles, called paraspeckles. 
 
POST-TRANSLATIONAL MODIFICATION:
 
Acetylated mainly by p300/CBP, recruited to the complex by CPSF6. Acetylation decreases interaction with PAPAO. Deacetylated by the class I/II HDACs, HDAC1, HDAC3 and HDAC10, and by the class III HDACs, SIRT1 AND SIRT2.



This protein can be a part of a given complexes: Activities in which Cleavage and polyadenylation specificity factor subunit 5 is involved: Pathways in which Cleavage and polyadenylation specificity factor subunit 5 is involved:

NCBI GI number(s): 5901926
59889569
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot O43809 O43809
BRENDA - -
KEGG hsa:11051 hsa:11051
PFAM: PF13869
PF13869
InterPro: IPR016706
IPR000086
IPR016706
IPR000086
CATH: - -
SCOP: - -
Solved crystal structures: 2CL3
2J8Q
3BAP
3BHO
3MDG
3MDI
3N9U
3P5T
3P6Y
3Q2S
3Q2T
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTK
EPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLG
TTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWR
PNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFE
LYDNAPGYGPIISSLPQLLSRFNFIYN

Cleavage and polyadenylation specificity factor subunit 5 (Homo sapiens) is product of expression of NUDT21 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Distinct sequence motifs within the 68-kDa subunit of cleavage factor Im mediate RNA binding, protein-protein interactions, and subcellular localization. Dettwiler S, Aringhieri C, Cardinale S, Keller W, Barabino SM J Biol Chem 2004-08-20 (279) 15169763
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
The full-ORF clone resource of the German cDNA Consortium. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I BMC Genomics 2007-01-01 (8) 17974005
Lysine acetylation targets protein complexes and co-regulates major cellular functions. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M Science 2009-08-14 (325) 19608861
Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ Nat Biotechnol 2005-02-01 (23) 15592455
The sequence and analysis of duplication-rich human chromosome 16. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M Nature 2004-12-23 (432) 15616553
Evidence that cleavage factor Im is a heterotetrameric protein complex controlling alternative polyadenylation. Kim S, Yamamoto J, Chen Y, Aida M, Wada T, Handa H, Yamaguchi Y Genes Cells 2010-09-01 (15) 20695905
Association of polyadenylation cleavage factor I with U1 snRNP. Awasthi S, Alwine JC RNA 2003-11-01 (9) 14561889
A mechanism for the regulation of pre-mRNA 3' processing by human cleavage factor Im. Brown KM, Gilmartin GM Mol Cell 2003-12-01 (12) 14690600
Purification and characterization of human cleavage factor Im involved in the 3' end processing of messenger RNA precursors. Ruegsegger U, Beyer K, Keller W J Biol Chem 1996-03-15 (271) 8626397
Multiple histone deacetylases and the CREB-binding protein regulate pre-mRNA 3'-end processing. Shimazu T, Horinouchi S, Yoshida M J Biol Chem 2007-01-16 (282) 17172643
Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping. Yang Q, Coseno M, Gilmartin GM, Doublie S Structure 2011-03-09 (19) 21295486
The crystal structure of human cleavage and polyadenylation specific factor-5 reveals a dimeric Nudix protein with a conserved catalytic site. Tresaugues L, Stenmark P, Schuler H, Flodin S, Welin M, Nyman T, Hammarstrom M, Moche M, Graslund S, Nordlund P Proteins 2008-12-01 (73) 18767156
Crystal structure of the 25 kDa subunit of human cleavage factor Im. Coseno M, Martin G, Berger C, Gilmartin G, Keller W, Doublie S Nucleic Acids Res 2008-06-01 (36) 18445629
Structural basis of UGUA recognition by the Nudix protein CFI(m)25 and implications for a regulatory role in mRNA 3' processing. Yang Q, Gilmartin GM, Doublie S Proc Natl Acad Sci U S A 2010-06-01 (107) 20479262
Human pre-mRNA cleavage factor Im is related to spliceosomal SR proteins and can be reconstituted in vitro from recombinant subunits. Ruegsegger U, Blank D, Keller W Mol Cell 1998-02-01 (1) 9659921



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.