Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Cleavage and polyadenylation specificity factor subunit 6

 
Known also as: Cleavage and polyadenylation specificity factor 68 kDa subunit, CPSF 68 kDa subunit, Pre-mRNA cleavage factor Im 68 kDa subunit, Protein HPBRII-4/7

Known abbreviations: CPSF6, CFIM68, CFIm68

 

FUNCTION:
 
Component of the cleavage factor Im complex (CFIm) that plays a key role in pre-mRNA 3'-processing. Involved in association with NUDT21/CPSF5 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. CPSF6 binds to cleavage and polyadenylation RNA substrates and promotes RNA looping. 
 
SUBUNIT STRUCTURE:
 
Component of the cleavage factor Im (CFIm) complex, composed at least of NUDT21/CPSF5 and CPSF6 or CPSF7. Within the cleavage factor Im complex, the NUDT21/CPSF5 homodimer is at the core of a heterotetramer, and is clasped by two additional subunits (CPSF6 or CPSF7). Interacts with NUDT21/CPSF5, SFRS3, SFRS7, SNRNP70 and TRA2B/SFRS10. 
 
CELLULAR LOCALIZATION:
 
Nucleus. Note: In punctate subnuclear structures localized adjacent to nuclear speckles, called paraspeckles. 
 
POST-TRANSLATIONAL MODIFICATION:
 
Phosphorylated upon DNA damage, probably by ATM or ATR



This protein can be a part of a given complexes: Activities in which Cleavage and polyadenylation specificity factor subunit 6 is involved: Pathways in which Cleavage and polyadenylation specificity factor subunit 6 is involved:

NCBI GI number(s): 162329583
162329582
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q16630 Q16630
BRENDA - -
KEGG hsa:11052 hsa:11052
PFAM: - Q16630 (Link - using uniprot id)
InterPro: IPR012677
IPR000504
IPR012677
IPR000504
CATH: - -
SCOP: - -
Solved crystal structures: 3P5T
3P6Y
3Q2S
3Q2T
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDR
DYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEA
VHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELH
GQNPVVTPCNKQFLSQFEMQSRKTTQSGQMSGEGKAGPPGGSSRAAFPQG
GRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPAGQTPPRPPLGPPGPPGPP
GPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPV
PGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGA
PPPAPHVNPAFFPPPTNSGMPTSDSRGPPPTDPYGRPPPYDRGDYGPPGR
EMDTARTPLSEAEFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVT
AISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGSGSRRERSRERDHS
RSREKSRRHKSRSRDRHDDYYRERSRERERHRDRDRDRDRERDREREYRH
R

Cleavage and polyadenylation specificity factor subunit 6 (Homo sapiens) is product of expression of CPSF6 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
Distinct sequence motifs within the 68-kDa subunit of cleavage factor Im mediate RNA binding, protein-protein interactions, and subcellular localization. Dettwiler S, Aringhieri C, Cardinale S, Keller W, Barabino SM J Biol Chem 2004-08-20 (279) 15169763
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ Science 2007-05-25 (316) 17525332
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK Sci Signal 2009-01-01 (2) 19690332
Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd J Proteome Res 2008-03-01 (7) 18220336
Evidence that cleavage factor Im is a heterotetrameric protein complex controlling alternative polyadenylation. Kim S, Yamamoto J, Chen Y, Aida M, Wada T, Handa H, Yamaguchi Y Genes Cells 2010-09-01 (15) 20695905
Association of polyadenylation cleavage factor I with U1 snRNP. Awasthi S, Alwine JC RNA 2003-11-01 (9) 14561889
A mechanism for the regulation of pre-mRNA 3' processing by human cleavage factor Im. Brown KM, Gilmartin GM Mol Cell 2003-12-01 (12) 14690600
Purification and characterization of human cleavage factor Im involved in the 3' end processing of messenger RNA precursors. Ruegsegger U, Beyer K, Keller W J Biol Chem 1996-03-15 (271) 8626397
Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping. Yang Q, Coseno M, Gilmartin GM, Doublie S Structure 2011-03-09 (19) 21295486
Human pre-mRNA cleavage factor Im is related to spliceosomal SR proteins and can be reconstituted in vitro from recombinant subunits. Ruegsegger U, Blank D, Keller W Mol Cell 1998-02-01 (1) 9659921



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.