Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

ATP-dependent RNA helicase DOB1

 
Known also as: mRNA transport regulator MTR4

Known abbreviations: MTR4, DOB1,YJL050W, J1158

 

FUNCTION:
 
ATP-dependent RNA helicase required for the 3'-end formation of 5.8S RNA. Cofactor for the exosome complex that unwinds secondary structure in pre-rRNA. Required for nucleocytoplasmic transport of mRNA. May serve as a chaperone which translocates or normalizes the structure of mRNAs in preparation for export. Component of the TRAMP complex which has a poly(A) RNA polymerase activity and is involved in a post-transcriptional quality control mechanism limiting inappropriate expression of genetic information. Polyadenylation is required for the degradative activity of the exosome on several of its nuclear RNA substrates. 
 
CATALYTIC ACTIVITY:
 
ATP + H2O = ADP + phosphate.
 
SUBUNIT STRUCTURE:
 
Component of the TRAMP complex (also called TRF4 complex) composed of at least HUL4, MTR4, PAP2/TRF4 and either AIR1 or AIR2.
 
CELLULAR LOCALIZATION:
 
Nucleus.



NCBI GI number(s): 6322411
296145969
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P47047 P47047
BRENDA - -
KEGG sce:YJL050W sce:YJL050W
PFAM: PF00270
PF08148
PF00271
PF13234
PF00270
PF08148
PF00271
PF13234
InterPro: IPR011545
IPR012961
IPR014001
IPR001650
IPR011254
IPR016438
IPR025696
IPR011545
IPR012961
IPR014001
IPR001650
IPR011254
IPR016438
IPR025696
CATH: - -
SCOP: - -
Solved crystal structures: 2XGJ
3L9O
[PDB] [details]
[PDB] [details]


Protein sequence:
MDSTDLFDVFEETPVELPTDSNGEKNADTNVGDTPDHTQDKKHGLEEEKE
EHEENNSENKKIKSNKSKTEDKNKKVVVPVLADSFEQEASREVDASKGLT
NSETLQVEQDGKVRLSHQVRHQVALPPNYDYTPIAEHKRVNEARTYPFTL
DPFQDTAISCIDRGESVLVSAHTSAGKTVVAEYAIAQSLKNKQRVIYTSP
IKALSNQKYRELLAEFGDVGLMTGDITINPDAGCLVMTTEILRSMLYRGS
EVMREVAWVIFDEVHYMRDKERGVVWEETIILLPDKVRYVFLSATIPNAM
EFAEWICKIHSQPCHIVYTNFRPTPLQHYLFPAHGDGIYLVVDEKSTFRE
ENFQKAMASISNQIGDDPNSTDSRGKKGQTYKGGSAKGDAKGDIYKIVKM
IWKKKYNPVIVFSFSKRDCEELALKMSKLDFNSDDEKEALTKIFNNAIAL
LPETDRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLF
ATETFSIGLNMPAKTVVFTSVRKWDGQQFRWVSGGEYIQMSGRAGRRGLD
DRGIVIMMIDEKMEPQVAKGMVKGQADRLDSAFHLGYNMILNLMRVEGIS
PEFMLEHSFFQFQNVISVPVMEKKLAELKKDFDGIEVEDEENVKEYHEIE
QAIKGYREDVRQVVTHPANALSFLQPGRLVEISVNGKDNYGWGAVVDFAK
RINKRNPSAVYTDHESYIVNVVVNTMYIDSPVNLLKPFNPTLPEGIRPAE
EGEKSICAVIPITLDSIKSIGNLRLYMPKDIRASGQKETVGKSLREVNRR
FPDGIPVLDPVKNMKIEDEDFLKLMKKIDVLNTKLSSNPLTNSMRLEELY
GKYSRKHDLHEDMKQLKRKISESQAVIQLDDLRRRKRVLRRLGFCTPNDI
IELKGRVACEISSGDELLLTELIFNGNFNELKPEQAAALLSCFAFQERCK
EAPRLKPELAEPLKAMREIAAKIAKIMKDSKIEVVEKDYVESFRHELMEV
VYEWCRGATFTQICKMTDVYEGSLIRMFKRLEELVKELVDVANTIGNSSL
KEKMEAVLKLIHRDIVSAGSLYL

ATP-dependent RNA helicase DOB1 (Saccharomyces cerevisiae) is product of expression of MTR4 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Dob1p (Mtr4p) is a putative ATP-dependent RNA helicase required for the 3' end formation of 5.8S rRNA in Saccharomyces cerevisiae. de la Cruz J, Kressler D, Tollervey D, Linder P EMBO J 1998-01-16 (17) 9463390
Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X. Galibert F, Alexandraki D, Baur A, Boles E, Chalwatzis N, Chuat JC, Coster F, Cziepluch C, De Haan M, Domdey H, Durand P, Entian KD, Gatius M, Goffeau A, Grivell LA, Hennemann A, Herbert CJ, Heumann K, Hilger F, Hollenberg CP, Huang ME, Jacq C, Jauniaux JC, Katsoulou C, Karpfinger-Hartl L, et al. EMBO J 1996-05-01 (15) 8641269
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A 2007-06-19 (104) 17563356
Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry. Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF Proc Natl Acad Sci U S A 2007-01-13 (104) 17287358
A new yeast poly(A) polymerase complex involved in RNA quality control. Vanacova S, Wolf J, Martin G, Blank D, Dettwiler S, Friedlein A, Langen H, Keith G, Keller W... PLoS Biol 2005-06-01 (3) 15828860
A DEAD-box-family protein is required for nucleocytoplasmic transport of yeast mRNA. Liang S, Hitomi M, Hu YH, Liu Y, Tartakoff AM... Mol Cell Biol 1996-09-01 (16) 8756671



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.