Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Protein AIR2

 
Known also as: Arginine methyltransferase-interacting RING finger protein 2

Known abbreviations: AIR2,YDL175C

 

FUNCTION:
 
Component of the TRAMP (TRF4) complex which has a poly(A) RNA polymerase activity and is involved in a post-transcriptional quality control mechanism limiting inappropriate expression of genetic information. Polyadenylation is required for the degradative activity of the exosome on several of its nuclear RNA substrates like cryptic transcripts generated by RNA polymerase II and III, or hypomethylated pre-tRNAi-Met. Both complexes polyadenylate RNA processing and degradation intermediates of snRNAs, snoRNAs and mRNAs that accumulate in strains lacking a functional exosome. AIR2 also inhibits the methylation of NPL3 mediated by HMT1 through its interaction with HMT1. 
 
SUBUNIT STRUCTURE:
 
Component of the TRAMP complex (also called TRF4 complex) composed of at least HUL4, MTR4, PAP2/TRF4 and either AIR1 or AIR2. Interacts with HMT1 and NPL3. The interaction with NPL3 requires the presence of HMT1. Interacts directly with PAP2. 
 
CELLULAR LOCALIZATION:
 
Nucleus.



NCBI GI number(s): 6320026
296143195
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q12476 Q12476
BRENDA - -
KEGG sce:YDL175C sce:YDL175C
PFAM: PF00098
PF00098
InterPro: IPR016713
IPR001878
IPR016713
IPR001878
CATH: - -
SCOP: - -
Solved crystal structures: 2LLI
3NYB
[PDB] [details]
[PDB] [details]


Protein sequence:
MEKNTAPFVVDTAPTTPPDKLVAPSIEEVNSNPNELRALRGQGRYFGVSD
DDKDAIKEAAPKCNNCSQRGHLKKDCPHIICSYCGATDDHYSRHCPKAIQ
CSKCDEVGHYRSQCPHKWKKVQCTLCKSKKHSKERCPSIWRAYILVDDNE
KAKPKVLPFHTIYCYNCGGKGHFGDDCKEKRSSRVPNEDGSAFTGSNLSV
ELKQEYYRHMNRNSDENEDYQFSESIYDEDPLPRPSHKRHSQNDHSHSGR
NKRRASNFHPPPYQKSNVIQPTIRGETLSLNNNISKNSRYQNTKVNVSSI
SENMYGSRYNPSTYVDNNSISNSSNYRNYNSYQPYRSGTLGKRR

Protein AIR2 (Saccharomyces cerevisiae) is product of expression of AIR2 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature 1997-05-01 (387) 9169867
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP J Proteome Res 2007-03-01 (6) 17330950
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A 2007-06-19 (104) 17563356
Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway. Gruhler A, Olsen JV, Mohammed S, Mortensen P, Faergeman NJ, Mann M, Jensen ON Mol Cell Proteomics 2005-03-01 (4) 15665377
Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Hamill S, Wolin SL, Reinisch KM... Proc Natl Acad Sci U S A 2010-08-24 (107) 20696927
RNA degradation by the exosome is promoted by a nuclear polyadenylation complex. LaCava J, Houseley J, Saveanu C, Petfalski E, Thompson E, Jacquier A, Tollervey D... Cell 2005-06-03 (121) 15935758
Cryptic pol II transcripts are degraded by a nuclear quality control pathway involving a new poly(A) polymerase. Wyers F, Rougemaille M, Badis G, Rousselle JC, Dufour ME, Boulay J, Regnault B, Devaux F, Namane A, Seraphin B, Libri D, Jacquier A... Cell 2005-06-03 (121) 15935759
A new yeast poly(A) polymerase complex involved in RNA quality control. Vanacova S, Wolf J, Martin G, Blank D, Dettwiler S, Friedlein A, Langen H, Keith G, Keller W... PLoS Biol 2005-06-01 (3) 15828860
Novel RING finger proteins, Air1p and Air2p, interact with Hmt1p and inhibit the arginine methylation of Npl3p. Inoue K, Mizuno T, Wada K, Hagiwara M... J Biol Chem 2000-10-20 (275) 10896665



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.