Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Poly(A) RNA polymerase protein 2

 
Known also as: DNA polymerase kappa,DNA polymerase sigma,Topoisomerase 1-related protein TRF4

Known abbreviations: PAP2, TRF4, YOL115W, HRC584, O0716

 

FUNCTION:
 
Catalytic subunit of the TRAMP complex which has a poly(A) RNA polymerase activity and is involved in a post-transcriptional quality control mechanism limiting inappropriate expression of genetic information. Polyadenylation is required for the degradative activity of the exosome on several of its nuclear RNA substrates like cryptic transcripts generated by RNA polymerase II and III, or hypomethylated pre-tRNAi-Met. Polyadenylates RNA processing and degradation intermediates of snRNAs, snoRNAs and mRNAs that accumulate in strains lacking a functional exosome. TRF4 is also required for proper nuclear division in mitosis, DNA damage repair and sister chromatid cohesion. Involved in the regulation of histone mRNA levels. May mediate mitotic chromosome condensation. 
 
CATALYTIC ACTIVITY:
 
ATP + RNA(n) = diphosphate + RNA(n+1). 
 
COFACTOR:
 
Magnesium or manganese (By similarity.)
 
SUBUNIT STRUCTURE:
 
Component of the TRAMP complex (also called TRF4 complex) composed of at least HUL4, MTR4, PAP2/TRF4 and either AIR1 or AIR2. Interacts with NOP53 and POL2. Interacts directly with AIR2.
 
CELLULAR LOCALIZATION:
 
Nucleus



NCBI GI number(s): 6324457
296147890
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P53632 P53632
BRENDA - -
KEGG sce:YOL115W sce:YOL115W
PFAM: PF01909
PF03828
PF01909
PF03828
InterPro: IPR002934
IPR002058
IPR002934
IPR002058
CATH: - -
SCOP: - -
Solved crystal structures: 3NYB
[PDB] [details]


Protein sequence:
MGAKSVTASSSKKIKNRHNGKVKKSKKIKKVRKPQKSISLNDENEVEILP
SRNEQETNKLPKDHVTADGILVLEHKSDDDEGFDVYDGHFDNPTDIPSTT
EESKTPSLAVHGDEKDLANNDDFISLSASSEDEQAEQEEEREKQELEIKK
EKQKEILNTDYPWILNHDHSKQKEISDWLTFEIKDFVAYISPSREEIEIR
NQTISTIREAVKQLWPDADLHVFGSYSTDLYLPGSDIDCVVTSELGGKES
RNNLYSLASHLKKKNLATEVEVVAKARVPIIKFVEPHSGIHIDVSFERTN
GIEAAKLIREWLDDTPGLRELVLIVKQFLHARRLNNVHTGGLGGFSIICL
VFSFLHMHPRIITNEIDPKDNLGVLLIEFFELYGKNFGYDDVALGSSDGY
PVYFPKSTWSAIQPIKNPFSLAIQDPGDESNNISRGSFNIRDIKKAFAGA
FDLLTNRCFELHSATFKDRLGKSILGNVIKYRGKARDFKDERGLVLNKAI
IENENYHKKRSRIIHDEDFAEDTVTSTATATTTDDDYEITNPPAKKAKIE
EKPESEPAKRNSGETYITVSSEDDDEDGYNPYTL

Poly(A) RNA polymerase protein 2 (Saccharomyces cerevisiae) is product of expression of PAP2 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
Nuclear surveillance and degradation of hypomodified initiator tRNAMet in S. cerevisiae. Kadaba S, Krueger A, Trice T, Krecic AM, Hinnebusch AG, Anderson J Genes Dev 2004-06-01 (18) 15145828
The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. Nature 1997-05-01 (387) 9169874
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Nop53p interacts with 5.8S rRNA co-transcriptionally, and regulates processing of pre-rRNA by the exosome. Granato DC, Machado-Santelli GM, Oliveira CC FEBS J 2008-08-01 (275) 18631361
Sequence analysis of a 44 kb DNA fragment of yeast chromosome XV including the Tyl-H3 retrotransposon, the suf1(+) frameshift suppressor gene for tRNA-Gly, the yeast transfer RNA-Thr-1a and a delta element. Vandenbol M, Durand P, Portetelle D, Hilger F Yeast 1995-09-15 (11) 7502582
Structure and function of the polymerase core of TRAMP, a RNA surveillance complex. Hamill S, Wolin SL, Reinisch KM... Proc Natl Acad Sci U S A 2010-08-24 (107) 20696927
Isolation of mutants of Saccharomyces cerevisiae requiring DNA topoisomerase I. Sadoff BU, Heath-Pagliuso S, Castano IB, Zhu Y, Kieff FS, Christman MF... Genetics 1995-10-01 (141) 8647385
Mitotic chromosome condensation in the rDNA requires TRF4 and DNA topoisomerase I in Saccharomyces cerevisiae. Castano IB, Brzoska PM, Sadoff BU, Chen H, Christman MF... Genes Dev 1996-10-15 (10) 8895658
A novel family of TRF (DNA topoisomerase I-related function) genes required for proper nuclear segregation. Castano IB, Heath-Pagliuso S, Sadoff BU, Fitzhugh DJ, Christman MF... Nucleic Acids Res 1996-06-15 (24) 8710513
The topoisomerase-related function gene TRF4 affects cellular sensitivity to the antitumor agent camptothecin. Walowsky C, Fitzhugh DJ, Castano IB, Ju JY, Levin NA, Christman MF... J Biol Chem 1999-03-12 (274) 10066793
Pol kappa: A DNA polymerase required for sister chromatid cohesion. Wang Z, Castano IB, De Las Penas A, Adams C, Christman MF... Science 2000-08-04 (289) 10926539
Eukaryotic DNA polymerases: proposal for a revised nomenclature. Burgers PM, Koonin EV, Bruford E, Blanco L, Burtis KC, Christman MF, Copeland WC, Friedberg EC, Hanaoka F, Hinkle DC, Lawrence CW, Nakanishi M, Ohmori H, Prakash L, Prakash S, Reynaud CA, Sugino A, Todo T, Wang Z, Weill JC, Woodgate R... J Biol Chem 2001-11-23 (276) 11579108
Cid13 is a cytoplasmic poly(A) polymerase that regulates ribonucleotide reductase mRNA. Saitoh S, Chabes A, McDonald WH, Thelander L, Yates JR, Russell P... Cell 2002-05-31 (109) 12062100
Structure/function analysis of the Saccharomyces cerevisiae Trf4/Pol sigma DNA polymerase. Wang Z, Castano IB, Adams C, Vu C, Fitzhugh D, Christman MF... Genetics 2002-01-01 (160) 11861546
Saccharomyces cerevisiae DNA polymerase epsilon and polymerase sigma interact physically and functionally, suggesting a role for polymerase epsilon in sister chromatid cohesion. Edwards S, Li CM, Levy DL, Brown J, Snow PM, Campbell JL... Mol Cell Biol 2003-04-01 (23) 12665575
RNA degradation by the exosome is promoted by a nuclear polyadenylation complex. LaCava J, Houseley J, Saveanu C, Petfalski E, Thompson E, Jacquier A, Tollervey D... Cell 2005-06-03 (121) 15935758
Cryptic pol II transcripts are degraded by a nuclear quality control pathway involving a new poly(A) polymerase. Wyers F, Rougemaille M, Badis G, Rousselle JC, Dufour ME, Boulay J, Regnault B, Devaux F, Namane A, Seraphin B, Libri D, Jacquier A... Cell 2005-06-03 (121) 15935759
Trf4 and Trf5 proteins of Saccharomyces cerevisiae exhibit poly(A) RNA polymerase activity but no DNA polymerase activity. Haracska L, Johnson RE, Prakash L, Prakash S... Mol Cell Biol 2005-11-01 (25) 16260630
A new yeast poly(A) polymerase complex involved in RNA quality control. Vanacova S, Wolf J, Martin G, Blank D, Dettwiler S, Friedlein A, Langen H, Keith G, Keller W... PLoS Biol 2005-06-01 (3) 15828860
Contributions of Trf4p- and Trf5p-dependent polyadenylation to the processing and degradative functions of the yeast nuclear exosome. Egecioglu DE, Henras AK, Chanfreau GF... RNA 2006-02-01 (12) 16373491
Nuclear RNA surveillance in Saccharomyces cerevisiae: Trf4p-dependent polyadenylation of nascent hypomethylated tRNA and an aberrant form of 5S rRNA. Kadaba S, Wang X, Anderson JT... RNA 2006-03-01 (12) 16431988
Contribution of Trf4/5 and the nuclear exosome to genome stability through regulation of histone mRNA levels in Saccharomyces cerevisiae. Reis CC, Campbell JL... Genetics 2007-03-01 (175) 17179095



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.